mirror of
https://github.com/KosinskiLab/AlphaPulldown.git
synced 2026-06-04 14:14:24 +08:00
- Strip _entity_poly_seq from generated template mmCIF so AF3 reconstructs _pdbx_poly_seq_scheme from _atom_site, avoiding UNK/gap mismatches - Build query_to_template_map using only residues with atoms to prevent OOB indexing in template features - Add --debug_templates flag to optionally dump generated template mmCIFs into templates_debug/ - Keep templates enabled; test test__chopped_dimer now passes
21 lines
412 B
JSON
Executable File
21 lines
412 B
JSON
Executable File
[{
|
|
"name": "test_protein_rna",
|
|
"modelSeeds": ["42"],
|
|
"sequences": [
|
|
{
|
|
"proteinChain": {
|
|
"sequence": "MSSHEGGKKKALKQPKKQAKEMDEEEKAFKQKQKEEQKKLEVLKAKVVGKGPLATGGIKKSGKK",
|
|
"count": 1,
|
|
"useStructureTemplate": true
|
|
}
|
|
},
|
|
{
|
|
"dnaSequence": {
|
|
"sequence": "GATTACA",
|
|
"count": 1
|
|
}
|
|
}
|
|
],
|
|
"dialect": "alphafoldserver",
|
|
"version": 1
|
|
}] |