Files
AlphaPulldown/test/test_data/features/test_alphafoldserver_prediction.json
Dima fc41c1a5eb AF3 templates: fix mmCIF parsing by removing synthetic _entity_poly_seq and mapping only present residues
- Strip _entity_poly_seq from generated template mmCIF so AF3 reconstructs _pdbx_poly_seq_scheme from _atom_site, avoiding UNK/gap mismatches
- Build query_to_template_map using only residues with atoms to prevent OOB indexing in template features
- Add --debug_templates flag to optionally dump generated template mmCIFs into templates_debug/
- Keep templates enabled; test test__chopped_dimer now passes
2025-08-12 14:04:33 +02:00

21 lines
412 B
JSON
Executable File

[{
"name": "test_protein_rna",
"modelSeeds": ["42"],
"sequences": [
{
"proteinChain": {
"sequence": "MSSHEGGKKKALKQPKKQAKEMDEEEKAFKQKQKEEQKKLEVLKAKVVGKGPLATGGIKKSGKK",
"count": 1,
"useStructureTemplate": true
}
},
{
"dnaSequence": {
"sequence": "GATTACA",
"count": 1
}
}
],
"dialect": "alphafoldserver",
"version": 1
}]