mirror of
https://github.com/molstar/molstar.git
synced 2026-06-05 14:04:36 +08:00
Compare commits
145 Commits
v0.7.0-dev
...
v0.7.1-dev
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
3415fe0847 | ||
|
|
1569958a29 | ||
|
|
3543faa0c2 | ||
|
|
251dbf3877 | ||
|
|
32d35efef0 | ||
|
|
8b6428a61d | ||
|
|
dda43370cf | ||
|
|
92c1e979c0 | ||
|
|
ad38a33943 | ||
|
|
88c276a4c7 | ||
|
|
0a3d19235d | ||
|
|
0d90fd1f06 | ||
|
|
02d3274e83 | ||
|
|
2531af2b94 | ||
|
|
850328be4e | ||
|
|
f8ce9cbb65 | ||
|
|
2af9d1cabf | ||
|
|
e8d1737d40 | ||
|
|
0328e93518 | ||
|
|
8a4ab9bdb9 | ||
|
|
410cdb193d | ||
|
|
a278337b4c | ||
|
|
b1308de0b9 | ||
|
|
9705078970 | ||
|
|
b1ca98e945 | ||
|
|
35054eaca9 | ||
|
|
2747c743c9 | ||
|
|
031d08a8d4 | ||
|
|
7cc6c4a9c8 | ||
|
|
ff27098514 | ||
|
|
545cd65066 | ||
|
|
84bfc6e7a9 | ||
|
|
2f71c4c5e4 | ||
|
|
1448f7aeb6 | ||
|
|
79d66a5cfc | ||
|
|
2ec19ac04c | ||
|
|
f62a6d4512 | ||
|
|
4fbcee3953 | ||
|
|
12bb283b97 | ||
|
|
13d776c7cb | ||
|
|
f45b48c6e1 | ||
|
|
ff14c94a90 | ||
|
|
0a0ef35b74 | ||
|
|
e3dc10c085 | ||
|
|
46113bf3d4 | ||
|
|
0f3ef61f7d | ||
|
|
86aae08257 | ||
|
|
06bf2c39a1 | ||
|
|
66a23bc2a2 | ||
|
|
51e86f1e43 | ||
|
|
78c70b3f5b | ||
|
|
8f52ffe061 | ||
|
|
e95b91ab84 | ||
|
|
f4dbd66496 | ||
|
|
5895df0499 | ||
|
|
6d0d88f3be | ||
|
|
7e71428cc3 | ||
|
|
2e215440f7 | ||
|
|
c04fa56c6c | ||
|
|
6c70b5e38f | ||
|
|
ad9160a4a3 | ||
|
|
c747d3928e | ||
|
|
68e8d67054 | ||
|
|
9e8fc76d28 | ||
|
|
d8970305de | ||
|
|
824675a658 | ||
|
|
090ad613cc | ||
|
|
ea35e09c96 | ||
|
|
d8b9a1a560 | ||
|
|
c259f58e63 | ||
|
|
9d4c2a1147 | ||
|
|
f13c3fe38b | ||
|
|
60409df145 | ||
|
|
1d7321cd6f | ||
|
|
eb68ccbf6b | ||
|
|
b1ece44c49 | ||
|
|
37ae274fb6 | ||
|
|
c900045fcd | ||
|
|
50d95ccf6a | ||
|
|
c9171444eb | ||
|
|
56ea62af71 | ||
|
|
9e81626928 | ||
|
|
84fda6e35d | ||
|
|
0f758cf554 | ||
|
|
a6605052db | ||
|
|
8514175da2 | ||
|
|
6a49427fc0 | ||
|
|
7c18e5eb86 | ||
|
|
2a7d258715 | ||
|
|
54fb9beeee | ||
|
|
27ebbc50d5 | ||
|
|
2a1b6e52b2 | ||
|
|
3110e82d92 | ||
|
|
4be999ce32 | ||
|
|
f0d7a4ed2a | ||
|
|
2dacfcb485 | ||
|
|
6218cc5371 | ||
|
|
b4808f2909 | ||
|
|
1a2e9eaa84 | ||
|
|
056ce42097 | ||
|
|
b14b5ca626 | ||
|
|
ffbaa944f2 | ||
|
|
e2ba96174a | ||
|
|
8c5d99bb54 | ||
|
|
b18b3be070 | ||
|
|
2e69b7c419 | ||
|
|
5007f5fb72 | ||
|
|
6fe83a9a70 | ||
|
|
20af084127 | ||
|
|
d6501170e6 | ||
|
|
5f33364514 | ||
|
|
7924c008fa | ||
|
|
2d2a53f28e | ||
|
|
1f7ffabef9 | ||
|
|
16d5c07224 | ||
|
|
2392bfb579 | ||
|
|
b4036f576c | ||
|
|
7e3cca5780 | ||
|
|
690d6812dc | ||
|
|
a44aa02f13 | ||
|
|
65ddd6d68a | ||
|
|
754025b3b1 | ||
|
|
f0649c5aa3 | ||
|
|
6df045211c | ||
|
|
0b9371527e | ||
|
|
8a00540de0 | ||
|
|
0d78905686 | ||
|
|
6edab203c2 | ||
|
|
0abfdb5ee3 | ||
|
|
88369158c9 | ||
|
|
8926575283 | ||
|
|
15b0288ce4 | ||
|
|
28853ec19d | ||
|
|
e3480a076a | ||
|
|
abf6452124 | ||
|
|
2cdd811dd3 | ||
|
|
be6fea39bf | ||
|
|
ed1bc2cd07 | ||
|
|
28d3d5861a | ||
|
|
95d3ef491f | ||
|
|
5c37ddfc6d | ||
|
|
4d9e2d9c91 | ||
|
|
0b1c18913d | ||
|
|
7aee2d805d | ||
|
|
06f03f399a |
2637
package-lock.json
generated
2637
package-lock.json
generated
File diff suppressed because it is too large
Load Diff
43
package.json
43
package.json
@@ -1,6 +1,6 @@
|
||||
{
|
||||
"name": "molstar",
|
||||
"version": "0.7.0-dev.6",
|
||||
"version": "0.7.1-dev.2",
|
||||
"description": "A comprehensive macromolecular library.",
|
||||
"homepage": "https://github.com/molstar/molstar#readme",
|
||||
"repository": {
|
||||
@@ -35,11 +35,12 @@
|
||||
"volume-server-test": "node lib/servers/servers/volume/server.js --idMap em 'test/${id}.mdb' --defaultPort 1336",
|
||||
"plugin-state": "node lib/servers/servers/plugin-state/index.js",
|
||||
"preversion": "npm run test",
|
||||
"postversion": "git push && git push --tags",
|
||||
"prepublishOnly": "npm run test && npm run build"
|
||||
"version": "npm run build",
|
||||
"postversion": "git push && git push --tags"
|
||||
},
|
||||
"files": [
|
||||
"lib/"
|
||||
"lib/",
|
||||
"build/viewer/"
|
||||
],
|
||||
"bin": {
|
||||
"cif2bcif": "lib/apps/cif2bcif/index.js",
|
||||
@@ -82,52 +83,52 @@
|
||||
],
|
||||
"license": "MIT",
|
||||
"devDependencies": {
|
||||
"@graphql-codegen/add": "^1.13.2",
|
||||
"@graphql-codegen/cli": "^1.13.2",
|
||||
"@graphql-codegen/time": "^1.13.2",
|
||||
"@graphql-codegen/typescript": "^1.13.2",
|
||||
"@graphql-codegen/typescript-graphql-files-modules": "^1.13.2",
|
||||
"@graphql-codegen/typescript-graphql-request": "^1.13.2",
|
||||
"@graphql-codegen/typescript-operations": "^1.13.2",
|
||||
"@graphql-codegen/add": "^1.13.3",
|
||||
"@graphql-codegen/cli": "^1.13.3",
|
||||
"@graphql-codegen/time": "^1.13.3",
|
||||
"@graphql-codegen/typescript": "^1.13.3",
|
||||
"@graphql-codegen/typescript-graphql-files-modules": "^1.13.3",
|
||||
"@graphql-codegen/typescript-graphql-request": "^1.13.3",
|
||||
"@graphql-codegen/typescript-operations": "^1.13.3",
|
||||
"@types/cors": "^2.8.6",
|
||||
"@typescript-eslint/eslint-plugin": "^2.28.0",
|
||||
"@typescript-eslint/parser": "^2.28.0",
|
||||
"@typescript-eslint/eslint-plugin": "^2.29.0",
|
||||
"@typescript-eslint/parser": "^2.29.0",
|
||||
"benchmark": "^2.1.4",
|
||||
"circular-dependency-plugin": "^5.2.0",
|
||||
"concurrently": "^5.1.0",
|
||||
"cpx2": "^2.0.0",
|
||||
"css-loader": "^3.5.2",
|
||||
"css-loader": "^3.5.3",
|
||||
"eslint": "^6.8.0",
|
||||
"extra-watch-webpack-plugin": "^1.0.3",
|
||||
"file-loader": "^6.0.0",
|
||||
"fs-extra": "^9.0.0",
|
||||
"graphql": "^15.0.0",
|
||||
"http-server": "^0.12.1",
|
||||
"jest": "^25.3.0",
|
||||
"jest": "^25.4.0",
|
||||
"jest-raw-loader": "^1.0.1",
|
||||
"mini-css-extract-plugin": "^0.9.0",
|
||||
"node-sass": "^4.13.1",
|
||||
"node-sass": "^4.14.0",
|
||||
"raw-loader": "^4.0.1",
|
||||
"resolve-url-loader": "^3.1.1",
|
||||
"sass-loader": "^8.0.2",
|
||||
"simple-git": "^1.132.0",
|
||||
"style-loader": "^1.1.4",
|
||||
"style-loader": "^1.2.0",
|
||||
"ts-jest": "^25.4.0",
|
||||
"typescript": "^3.8.3",
|
||||
"webpack": "^4.42.1",
|
||||
"webpack": "^4.43.0",
|
||||
"webpack-cli": "^3.3.11",
|
||||
"webpack-version-file-plugin": "^0.4.0"
|
||||
},
|
||||
"dependencies": {
|
||||
"@material-ui/core": "^4.9.10",
|
||||
"@material-ui/core": "^4.9.11",
|
||||
"@material-ui/icons": "^4.9.1",
|
||||
"@types/argparse": "^1.0.38",
|
||||
"@types/benchmark": "^1.0.31",
|
||||
"@types/compression": "1.7.0",
|
||||
"@types/express": "^4.17.6",
|
||||
"@types/jest": "^25.2.1",
|
||||
"@types/node": "^13.13.0",
|
||||
"@types/node-fetch": "^2.5.6",
|
||||
"@types/node": "^13.13.2",
|
||||
"@types/node-fetch": "^2.5.7",
|
||||
"@types/react": "^16.9.34",
|
||||
"@types/react-dom": "^16.9.6",
|
||||
"@types/swagger-ui-dist": "3.0.5",
|
||||
|
||||
@@ -117,7 +117,7 @@ export function printSequence(model: Model) {
|
||||
for (const key of Object.keys(byEntityKey)) {
|
||||
const { sequence, entityId } = byEntityKey[+key];
|
||||
const { seqId, compId } = sequence;
|
||||
console.log(`${entityId} (${sequence.kind} ${seqId.value(0)} (offset ${sequence.offset}), ${seqId.value(seqId.rowCount - 1)}) (${compId.value(0)}, ${compId.value(compId.rowCount - 1)})`);
|
||||
console.log(`${entityId} (${sequence.kind} ${seqId.value(0)}, ${seqId.value(seqId.rowCount - 1)}) (${compId.value(0)}, ${compId.value(compId.rowCount - 1)})`);
|
||||
console.log(`${Sequence.getSequenceString(sequence)}`);
|
||||
}
|
||||
console.log();
|
||||
|
||||
@@ -8,38 +8,36 @@ import * as fs from 'fs';
|
||||
import * as argparse from 'argparse';
|
||||
import * as util from 'util';
|
||||
|
||||
import { VolumeData, VolumeIsoValue } from '../../mol-model/volume';
|
||||
import { Volume } from '../../mol-model/volume';
|
||||
import { downloadCif } from './helpers';
|
||||
import { CIF } from '../../mol-io/reader/cif';
|
||||
import { DensityServer_Data_Database } from '../../mol-io/reader/cif/schema/density-server';
|
||||
import { Table } from '../../mol-data/db';
|
||||
import { StringBuilder } from '../../mol-util';
|
||||
import { Task } from '../../mol-task';
|
||||
import { createVolumeIsosurfaceMesh } from '../../mol-repr/volume/isosurface';
|
||||
import { Theme } from '../../mol-theme/theme';
|
||||
import { volumeFromDensityServerData } from '../../mol-model-formats/volume/density-server';
|
||||
import { volumeFromDensityServerData, DscifFormat } from '../../mol-model-formats/volume/density-server';
|
||||
|
||||
require('util.promisify').shim();
|
||||
const writeFileAsync = util.promisify(fs.writeFile);
|
||||
|
||||
type Volume = { source: DensityServer_Data_Database, volume: VolumeData }
|
||||
|
||||
async function getVolume(url: string): Promise<Volume> {
|
||||
const cif = await downloadCif(url, true);
|
||||
const data = CIF.schema.densityServer(cif.blocks[1]);
|
||||
return { source: data, volume: await volumeFromDensityServerData(data).run() };
|
||||
return await volumeFromDensityServerData(data).run();
|
||||
}
|
||||
|
||||
function print(data: Volume) {
|
||||
const { volume_data_3d_info } = data.source;
|
||||
function print(volume: Volume) {
|
||||
if (!DscifFormat.is(volume.sourceData)) return;
|
||||
const { volume_data_3d_info } = volume.sourceData.data;
|
||||
const row = Table.getRow(volume_data_3d_info, 0);
|
||||
console.log(row);
|
||||
if (data.volume.transform) console.log(data.volume.transform);
|
||||
console.log(data.volume.dataStats);
|
||||
console.log(volume.grid.transform);
|
||||
console.log(volume.grid.stats);
|
||||
}
|
||||
|
||||
async function doMesh(data: Volume, filename: string) {
|
||||
const mesh = await Task.create('', runtime => createVolumeIsosurfaceMesh({ runtime }, data.volume, Theme.createEmpty(), { isoValue: VolumeIsoValue.absolute(1.5) } )).run();
|
||||
async function doMesh(volume: Volume, filename: string) {
|
||||
const mesh = await Task.create('', runtime => createVolumeIsosurfaceMesh({ runtime }, volume, Theme.createEmpty(), { isoValue: Volume.IsoValue.absolute(1.5) } )).run();
|
||||
console.log({ vc: mesh.vertexCount, tc: mesh.triangleCount });
|
||||
|
||||
// Export the mesh in OBJ format.
|
||||
|
||||
63
src/apps/viewer/embedded.html
Normal file
63
src/apps/viewer/embedded.html
Normal file
@@ -0,0 +1,63 @@
|
||||
<!DOCTYPE html>
|
||||
<html lang="en">
|
||||
<head>
|
||||
<meta charset="utf-8" />
|
||||
<meta name="viewport" content="width=device-width, user-scalable=no, minimum-scale=1.0, maximum-scale=1.0">
|
||||
<link rel="icon" href="./favicon.ico" type="image/x-icon">
|
||||
<title>Embedded Mol* Viewer</title>
|
||||
<style>
|
||||
#app {
|
||||
position: absolute;
|
||||
left: 100px;
|
||||
top: 100px;
|
||||
width: 800px;
|
||||
height: 600px;
|
||||
}
|
||||
</style>
|
||||
<link rel="stylesheet" type="text/css" href="molstar.css" />
|
||||
</head>
|
||||
<body>
|
||||
<div id="app"></div>
|
||||
<script type="text/javascript" src="./molstar.js"></script>
|
||||
<script type="text/javascript">
|
||||
var viewer = new molstar.Viewer('app', {
|
||||
layoutIsExpanded: false,
|
||||
layoutShowControls: false,
|
||||
layoutShowRemoteState: false,
|
||||
layoutShowSequence: true,
|
||||
layoutShowLog: false,
|
||||
layoutShowLeftPanel: true,
|
||||
|
||||
viewportShowExpand: true,
|
||||
viewportShowSelectionMode: false,
|
||||
viewportShowAnimation: false,
|
||||
|
||||
pdbProvider: 'rcsb',
|
||||
emdbProvider: 'rcsb',
|
||||
});
|
||||
viewer.loadPdb('7bv2');
|
||||
viewer.loadEmdb('EMD-30210');
|
||||
|
||||
// TODO add Volume.customProperty and load suggested isoValue via custom property
|
||||
var sub = viewer.plugin.managers.volume.hierarchy.behaviors.selection.subscribe(function (value) {
|
||||
if (value.volume?.representations[0]) {
|
||||
var ref = value.volume.representations[0].cell;
|
||||
var tree = viewer.plugin.state.data.build().to(ref).update({
|
||||
type: {
|
||||
name: 'isosurface',
|
||||
params: {
|
||||
isoValue: {
|
||||
kind: 'relative',
|
||||
relativeValue: 6
|
||||
}
|
||||
}
|
||||
},
|
||||
colorTheme: ref.transform.params?.colorTheme
|
||||
});
|
||||
viewer.plugin.runTask(viewer.plugin.state.data.updateTree(tree));
|
||||
if (typeof sub !== 'undefined') sub.unsubscribe();
|
||||
}
|
||||
});
|
||||
</script>
|
||||
</body>
|
||||
</html>
|
||||
@@ -34,10 +34,50 @@
|
||||
height: 600px;
|
||||
}
|
||||
</style>
|
||||
<link rel="stylesheet" type="text/css" href="app.css" />
|
||||
<link rel="stylesheet" type="text/css" href="molstar.css" />
|
||||
</head>
|
||||
<body>
|
||||
<div id="app"></div>
|
||||
<script type="text/javascript" src="./index.js"></script>
|
||||
<script type="text/javascript" src="./molstar.js"></script>
|
||||
<script type="text/javascript">
|
||||
function getParam(name, regex) {
|
||||
var r = new RegExp(name + '=' + '(' + regex + ')[&]?', 'i');
|
||||
return decodeURIComponent(((window.location.search || '').match(r) || [])[1] || '');
|
||||
}
|
||||
|
||||
var debugMode = getParam('debug-mode', '[^&]+').trim() === '1';
|
||||
if (debugMode) molstar.setDebugMode(debugMode);
|
||||
|
||||
var hideControls = getParam('hide-controls', '[^&]+').trim() === '1';
|
||||
var pdbProvider = getParam('pdb-provider', '[^&]+').trim().toLowerCase();
|
||||
var emdbProvider = getParam('emdb-provider', '[^&]+').trim().toLowerCase();
|
||||
var viewer = new molstar.Viewer('app', {
|
||||
layoutShowControls: !hideControls,
|
||||
viewportShowExpand: false,
|
||||
pdbProvider: pdbProvider || 'pdbe',
|
||||
emdbProvider: emdbProvider || 'pdbe',
|
||||
});
|
||||
|
||||
var snapshotId = getParam('snapshot-id', '[^&]+').trim();
|
||||
if (snapshotId) viewer.setRemoteSnapshot(snapshotId);
|
||||
|
||||
var snapshotUrl = getParam('snapshot-url', '[^&]+').trim();
|
||||
var snapshotUrlType = getParam('snapshot-url-type', '[^&]+').toLowerCase().trim() || 'molj';
|
||||
if (snapshotUrl && snapshotUrlType) viewer.loadSnapshotFromUrl(snapshotUrl, snapshotUrlType);
|
||||
|
||||
var structureUrl = getParam('structure-url', '[^&]+').trim();
|
||||
var structureUrlFormat = getParam('structure-url-format', '[a-z]+').toLowerCase().trim();
|
||||
var structureUrlIsBinary = getParam('structure-url-is-binary', '[^&]+').trim() === '1';
|
||||
if (structureUrl) viewer.loadStructureFromUrl(structureUrl, structureUrlFormat, structureUrlIsBinary);
|
||||
|
||||
var pdb = getParam('pdb', '[^&]+').trim();
|
||||
if (pdb) viewer.loadPdb(pdb);
|
||||
|
||||
var pdbDev = getParam('pdb-dev', '[^&]+').trim();
|
||||
if (pdbDev) viewer.loadPdbDev(pdbDev);
|
||||
|
||||
var emdb = getParam('emdb', '[^&]+').trim();
|
||||
if (emdb) viewer.loadEmdb(emdb);
|
||||
</script>
|
||||
</body>
|
||||
</html>
|
||||
@@ -8,84 +8,114 @@
|
||||
import '../../mol-util/polyfill';
|
||||
import { createPlugin, DefaultPluginSpec } from '../../mol-plugin';
|
||||
import './index.html';
|
||||
import './embedded.html';
|
||||
import './favicon.ico';
|
||||
import { PluginContext } from '../../mol-plugin/context';
|
||||
import { PluginCommands } from '../../mol-plugin/commands';
|
||||
import { PluginSpec } from '../../mol-plugin/spec';
|
||||
import { DownloadStructure } from '../../mol-plugin-state/actions/structure';
|
||||
import { DownloadStructure, PdbDownloadProvider } from '../../mol-plugin-state/actions/structure';
|
||||
import { PluginConfig } from '../../mol-plugin/config';
|
||||
import { CellPack } from '../../extensions/cellpack';
|
||||
import { RCSBAssemblySymmetry, RCSBValidationReport } from '../../extensions/rcsb';
|
||||
import { PDBeStructureQualityReport } from '../../extensions/pdbe';
|
||||
import { Asset } from '../../mol-util/assets';
|
||||
import { ObjectKeys } from '../../mol-util/type-helpers';
|
||||
import { PluginState } from '../../mol-plugin/state';
|
||||
import { DownloadDensity } from '../../mol-plugin-state/actions/volume';
|
||||
import { PluginLayoutControlsDisplay } from '../../mol-plugin/layout';
|
||||
|
||||
require('mol-plugin-ui/skin/light.scss');
|
||||
|
||||
function getParam(name: string, regex: string): string {
|
||||
let r = new RegExp(`${name}=(${regex})[&]?`, 'i');
|
||||
return decodeURIComponent(((window.location.search || '').match(r) || [])[1] || '');
|
||||
}
|
||||
export { PLUGIN_VERSION as version } from '../../mol-plugin/version';
|
||||
export { setProductionMode, setDebugMode } from '../../mol-util/debug';
|
||||
|
||||
const hideControls = getParam('hide-controls', `[^&]+`) === '1';
|
||||
const Extensions = {
|
||||
'cellpack': PluginSpec.Behavior(CellPack),
|
||||
'pdbe-structure-quality-report': PluginSpec.Behavior(PDBeStructureQualityReport),
|
||||
'rcsb-assembly-symmetry': PluginSpec.Behavior(RCSBAssemblySymmetry),
|
||||
'rcsb-validation-report': PluginSpec.Behavior(RCSBValidationReport)
|
||||
};
|
||||
|
||||
function init() {
|
||||
const spec: PluginSpec = {
|
||||
actions: [...DefaultPluginSpec.actions],
|
||||
behaviors: [
|
||||
...DefaultPluginSpec.behaviors,
|
||||
PluginSpec.Behavior(CellPack),
|
||||
PluginSpec.Behavior(PDBeStructureQualityReport),
|
||||
PluginSpec.Behavior(RCSBAssemblySymmetry),
|
||||
PluginSpec.Behavior(RCSBValidationReport),
|
||||
],
|
||||
animations: [...DefaultPluginSpec.animations || []],
|
||||
customParamEditors: DefaultPluginSpec.customParamEditors,
|
||||
layout: {
|
||||
initial: {
|
||||
isExpanded: true,
|
||||
showControls: !hideControls
|
||||
const DefaultViewerOptions = {
|
||||
extensions: ObjectKeys(Extensions),
|
||||
layoutIsExpanded: true,
|
||||
layoutShowControls: true,
|
||||
layoutShowRemoteState: true,
|
||||
layoutControlsDisplay: 'reactive' as PluginLayoutControlsDisplay,
|
||||
layoutShowSequence: true,
|
||||
layoutShowLog: true,
|
||||
layoutShowLeftPanel: true,
|
||||
|
||||
viewportShowExpand: PluginConfig.Viewport.ShowExpand.defaultValue,
|
||||
viewportShowSelectionMode: PluginConfig.Viewport.ShowSelectionMode.defaultValue,
|
||||
viewportShowAnimation: PluginConfig.Viewport.ShowAnimation.defaultValue,
|
||||
pluginStateServer: PluginConfig.State.DefaultServer.defaultValue,
|
||||
volumeStreamingServer: PluginConfig.VolumeStreaming.DefaultServer.defaultValue,
|
||||
pdbProvider: PluginConfig.Download.DefaultPdbProvider.defaultValue,
|
||||
emdbProvider: PluginConfig.Download.DefaultEmdbProvider.defaultValue,
|
||||
};
|
||||
type ViewerOptions = typeof DefaultViewerOptions;
|
||||
|
||||
export class Viewer {
|
||||
plugin: PluginContext
|
||||
|
||||
constructor(elementId: string, options: Partial<ViewerOptions> = {}) {
|
||||
const o = { ...DefaultViewerOptions, ...options };
|
||||
|
||||
const spec: PluginSpec = {
|
||||
actions: [...DefaultPluginSpec.actions],
|
||||
behaviors: [
|
||||
...DefaultPluginSpec.behaviors,
|
||||
...o.extensions.map(e => Extensions[e]),
|
||||
],
|
||||
animations: [...DefaultPluginSpec.animations || []],
|
||||
customParamEditors: DefaultPluginSpec.customParamEditors,
|
||||
layout: {
|
||||
initial: {
|
||||
isExpanded: o.layoutIsExpanded,
|
||||
showControls: o.layoutShowControls,
|
||||
controlsDisplay: o.layoutControlsDisplay,
|
||||
},
|
||||
controls: {
|
||||
...DefaultPluginSpec.layout && DefaultPluginSpec.layout.controls,
|
||||
top: o.layoutShowSequence ? undefined : 'none',
|
||||
bottom: o.layoutShowLog ? undefined : 'none',
|
||||
left: o.layoutShowLeftPanel ? undefined : 'none',
|
||||
}
|
||||
},
|
||||
controls: {
|
||||
...DefaultPluginSpec.layout && DefaultPluginSpec.layout.controls
|
||||
}
|
||||
},
|
||||
config: DefaultPluginSpec.config
|
||||
};
|
||||
spec.config?.set(PluginConfig.Viewport.ShowExpand, false);
|
||||
const plugin = createPlugin(document.getElementById('app')!, spec);
|
||||
trySetSnapshot(plugin);
|
||||
tryLoadFromUrl(plugin);
|
||||
}
|
||||
components: {
|
||||
...DefaultPluginSpec.components,
|
||||
remoteState: o.layoutShowRemoteState ? 'default' : 'none',
|
||||
},
|
||||
config: [
|
||||
[PluginConfig.Viewport.ShowExpand, o.viewportShowExpand],
|
||||
[PluginConfig.Viewport.ShowSelectionMode, o.viewportShowSelectionMode],
|
||||
[PluginConfig.Viewport.ShowAnimation, o.viewportShowAnimation],
|
||||
[PluginConfig.State.DefaultServer, o.pluginStateServer],
|
||||
[PluginConfig.State.CurrentServer, o.pluginStateServer],
|
||||
[PluginConfig.VolumeStreaming.DefaultServer, o.volumeStreamingServer],
|
||||
[PluginConfig.Download.DefaultPdbProvider, o.pdbProvider],
|
||||
[PluginConfig.Download.DefaultEmdbProvider, o.emdbProvider]
|
||||
]
|
||||
};
|
||||
|
||||
async function trySetSnapshot(ctx: PluginContext) {
|
||||
try {
|
||||
const snapshotUrl = getParam('snapshot-url', `[^&]+`);
|
||||
const snapshotId = getParam('snapshot-id', `[^&]+`);
|
||||
if (!snapshotUrl && !snapshotId) return;
|
||||
// TODO parametrize the server
|
||||
const url = snapshotId
|
||||
? `https://webchem.ncbr.muni.cz/molstar-state/get/${snapshotId}`
|
||||
: snapshotUrl;
|
||||
await PluginCommands.State.Snapshots.Fetch(ctx, { url });
|
||||
} catch (e) {
|
||||
ctx.log.error('Failed to load snapshot.');
|
||||
console.warn('Failed to load snapshot', e);
|
||||
const element = document.getElementById(elementId);
|
||||
if (!element) throw new Error(`Could not get element with id '${elementId}'`);
|
||||
this.plugin = createPlugin(element, spec);
|
||||
}
|
||||
}
|
||||
|
||||
async function tryLoadFromUrl(ctx: PluginContext) {
|
||||
const url = getParam('loadFromURL', '[^&]+').trim();
|
||||
try {
|
||||
if (!url) return;
|
||||
async setRemoteSnapshot(id: string) {
|
||||
const url = `${this.plugin.config.get(PluginConfig.State.CurrentServer)}/get/${id}`;
|
||||
await PluginCommands.State.Snapshots.Fetch(this.plugin, { url });
|
||||
}
|
||||
|
||||
let format = 'cif', isBinary = false;
|
||||
switch (getParam('loadFromURLFormat', '[a-z]+').toLocaleLowerCase().trim()) {
|
||||
case 'pdb': format = 'pdb'; break;
|
||||
case 'mmbcif': isBinary = true; break;
|
||||
}
|
||||
async loadSnapshotFromUrl(url: string, type: PluginState.SnapshotType) {
|
||||
await PluginCommands.State.Snapshots.OpenUrl(this.plugin, { url, type });
|
||||
}
|
||||
|
||||
const params = DownloadStructure.createDefaultParams(void 0 as any, ctx);
|
||||
|
||||
return ctx.runTask(ctx.state.data.applyAction(DownloadStructure, {
|
||||
async loadStructureFromUrl(url: string, format = 'cif', isBinary = false) {
|
||||
const params = DownloadStructure.createDefaultParams(this.plugin.state.data.root.obj!, this.plugin);
|
||||
return this.plugin.runTask(this.plugin.state.data.applyAction(DownloadStructure, {
|
||||
source: {
|
||||
name: 'url',
|
||||
params: {
|
||||
@@ -96,10 +126,57 @@ async function tryLoadFromUrl(ctx: PluginContext) {
|
||||
}
|
||||
}
|
||||
}));
|
||||
} catch (e) {
|
||||
ctx.log.error(`Failed to load from URL (${url})`);
|
||||
console.warn(`Failed to load from URL (${url})`, e);
|
||||
}
|
||||
}
|
||||
|
||||
init();
|
||||
async loadPdb(pdb: string) {
|
||||
const params = DownloadStructure.createDefaultParams(this.plugin.state.data.root.obj!, this.plugin);
|
||||
const provider = this.plugin.config.get(PluginConfig.Download.DefaultPdbProvider)!;
|
||||
return this.plugin.runTask(this.plugin.state.data.applyAction(DownloadStructure, {
|
||||
source: {
|
||||
name: 'pdb' as const,
|
||||
params: {
|
||||
provider: {
|
||||
id: pdb,
|
||||
server: {
|
||||
name: provider,
|
||||
params: PdbDownloadProvider[provider].defaultValue as any
|
||||
}
|
||||
},
|
||||
options: params.source.params.options,
|
||||
}
|
||||
}
|
||||
}));
|
||||
}
|
||||
|
||||
async loadPdbDev(pdbDev: string) {
|
||||
const params = DownloadStructure.createDefaultParams(this.plugin.state.data.root.obj!, this.plugin);
|
||||
return this.plugin.runTask(this.plugin.state.data.applyAction(DownloadStructure, {
|
||||
source: {
|
||||
name: 'pdb-dev' as const,
|
||||
params: {
|
||||
provider: {
|
||||
id: pdbDev,
|
||||
encoding: 'bcif',
|
||||
},
|
||||
options: params.source.params.options,
|
||||
}
|
||||
}
|
||||
}));
|
||||
}
|
||||
|
||||
async loadEmdb(emdb: string) {
|
||||
const provider = this.plugin.config.get(PluginConfig.Download.DefaultEmdbProvider)!;
|
||||
return this.plugin.runTask(this.plugin.state.data.applyAction(DownloadDensity, {
|
||||
source: {
|
||||
name: 'pdb-emd-ds' as const,
|
||||
params: {
|
||||
provider: {
|
||||
id: emdb,
|
||||
server: provider,
|
||||
},
|
||||
detail: 3,
|
||||
}
|
||||
}
|
||||
}));
|
||||
}
|
||||
}
|
||||
@@ -41,7 +41,7 @@
|
||||
display: block;
|
||||
}
|
||||
</style>
|
||||
<link rel="stylesheet" type="text/css" href="app.css" />
|
||||
<link rel="stylesheet" type="text/css" href="molstar.css" />
|
||||
<script type="text/javascript" src="./index.js"></script>
|
||||
</head>
|
||||
<body>
|
||||
@@ -55,13 +55,13 @@
|
||||
</select>
|
||||
</div>
|
||||
<div id="app"></div>
|
||||
<script>
|
||||
<script>
|
||||
function $(id) { return document.getElementById(id); }
|
||||
|
||||
|
||||
var pdbId = '1grm', assemblyId= '1';
|
||||
var url = 'https://www.ebi.ac.uk/pdbe/static/entry/' + pdbId + '_updated.cif';
|
||||
var format = 'mmcif';
|
||||
|
||||
|
||||
$('url').value = url;
|
||||
$('url').onchange = function (e) { url = e.target.value; }
|
||||
$('assemblyId').value = assemblyId;
|
||||
@@ -86,7 +86,7 @@
|
||||
|
||||
addHeader('Camera');
|
||||
addControl('Toggle Spin', () => BasicMolStarWrapper.toggleSpin());
|
||||
|
||||
|
||||
addSeparator();
|
||||
|
||||
addHeader('Animation');
|
||||
@@ -115,7 +115,7 @@
|
||||
addControl('Static Superposition', () => BasicMolStarWrapper.tests.staticSuperposition());
|
||||
addControl('Dynamic Superposition', () => BasicMolStarWrapper.tests.dynamicSuperposition());
|
||||
addControl('Validation Tooltip', () => BasicMolStarWrapper.tests.toggleValidationTooltip());
|
||||
|
||||
|
||||
addControl('Show Toasts', () => BasicMolStarWrapper.tests.showToasts());
|
||||
addControl('Hide Toasts', () => BasicMolStarWrapper.tests.hideToasts());
|
||||
|
||||
|
||||
@@ -6,7 +6,7 @@
|
||||
|
||||
import { Mat4 } from '../../mol-math/linear-algebra';
|
||||
import { QueryContext, StructureSelection } from '../../mol-model/structure';
|
||||
import { superposeStructures } from '../../mol-model/structure/structure/util/superposition';
|
||||
import { superpose } from '../../mol-model/structure/structure/util/superposition';
|
||||
import { PluginStateObject as PSO } from '../../mol-plugin-state/objects';
|
||||
import { PluginContext } from '../../mol-plugin/context';
|
||||
import { MolScriptBuilder as MS } from '../../mol-script/language/builder';
|
||||
@@ -79,7 +79,7 @@ export function dynamicSuperpositionTest(plugin: PluginContext, src: string[], c
|
||||
const xs = plugin.managers.structure.hierarchy.current.structures;
|
||||
const selections = xs.map(s => StructureSelection.toLociWithCurrentUnits(query(new QueryContext(s.cell.obj!.data))));
|
||||
|
||||
const transforms = superposeStructures(selections);
|
||||
const transforms = superpose(selections);
|
||||
|
||||
await siteVisual(plugin, xs[0].cell, pivot, rest);
|
||||
for (let i = 1; i < selections.length; i++) {
|
||||
|
||||
@@ -38,16 +38,16 @@
|
||||
display: block;
|
||||
}
|
||||
</style>
|
||||
<link rel="stylesheet" type="text/css" href="app.css" />
|
||||
<link rel="stylesheet" type="text/css" href="molstar.css" />
|
||||
<script type="text/javascript" src="./index.js"></script>
|
||||
</head>
|
||||
<body>
|
||||
<div id='controls'></div>
|
||||
<div id="app"></div>
|
||||
<script>
|
||||
<script>
|
||||
LightingDemo.init('app')
|
||||
LightingDemo.load({ url: 'https://files.rcsb.org/download/1M07.cif', assemblyId: '1' })
|
||||
|
||||
|
||||
addHeader('Example PDB IDs');
|
||||
addControl('1M07', () => LightingDemo.load({ url: 'https://files.rcsb.org/download/1M07.cif', assemblyId: '1' }));
|
||||
addControl('6HY0', () => LightingDemo.load({ url: 'https://files.rcsb.org/download/6HY0.cif', assemblyId: '1' }));
|
||||
|
||||
@@ -48,7 +48,7 @@
|
||||
width: 300px;
|
||||
}
|
||||
</style>
|
||||
<link rel="stylesheet" type="text/css" href="app.css" />
|
||||
<link rel="stylesheet" type="text/css" href="molstar.css" />
|
||||
<script type="text/javascript" src="./index.js"></script>
|
||||
</head>
|
||||
<body>
|
||||
@@ -65,7 +65,7 @@
|
||||
<div id="app"></div>
|
||||
<div id="volume-streaming-wrapper"></div>
|
||||
<script>
|
||||
// it might be a good idea to define these colors in a separate script file
|
||||
// it might be a good idea to define these colors in a separate script file
|
||||
var CustomColors = [0x00ff00, 0x0000ff];
|
||||
|
||||
// create an instance of the plugin
|
||||
@@ -74,11 +74,11 @@
|
||||
console.log('Wrapper version', MolStarProteopediaWrapper.VERSION_MAJOR, MolStarProteopediaWrapper.VERSION_MINOR);
|
||||
|
||||
function $(id) { return document.getElementById(id); }
|
||||
|
||||
|
||||
var pdbId = '1cbs', assemblyId= 'preferred', isBinary = true;
|
||||
var url = 'https://www.ebi.ac.uk/pdbe/entry-files/download/' + pdbId + '.bcif'
|
||||
var format = 'cif';
|
||||
|
||||
|
||||
$('url').value = url;
|
||||
$('url').onchange = function (e) { url = e.target.value; }
|
||||
$('assemblyId').value = assemblyId;
|
||||
@@ -92,6 +92,12 @@
|
||||
// var format = 'pdb';
|
||||
// var assemblyId = 'deposited';
|
||||
|
||||
function loadAndSnapshot(params) {
|
||||
PluginWrapper.load(params).then(() => {
|
||||
setTimeout(() => snapshot = PluginWrapper.plugin.state.getSnapshot({ canvas3d: false /* do not save spinning state */ }), 500);
|
||||
});
|
||||
}
|
||||
|
||||
var representationStyle = {
|
||||
// sequence: { coloring: 'proteopedia-custom' }, // or just { }
|
||||
hetGroups: { kind: 'ball-and-stick' }, // or 'spacefill
|
||||
@@ -103,7 +109,7 @@
|
||||
customColorList: CustomColors
|
||||
});
|
||||
PluginWrapper.setBackground(0xffffff);
|
||||
PluginWrapper.load({ url: url, format: format, isBinary: isBinary, assemblyId: assemblyId, representationStyle: representationStyle });
|
||||
loadAndSnapshot({ url: url, format: format, isBinary: isBinary, assemblyId: assemblyId, representationStyle: representationStyle });
|
||||
PluginWrapper.toggleSpin();
|
||||
|
||||
PluginWrapper.events.modelInfo.subscribe(function (info) {
|
||||
@@ -111,8 +117,8 @@
|
||||
listHetGroups(info);
|
||||
});
|
||||
|
||||
addControl('Load Asym Unit', () => PluginWrapper.load({ url: url, format: format, isBinary }));
|
||||
addControl('Load Assembly', () => PluginWrapper.load({ url: url, format: format, isBinary, assemblyId: assemblyId }));
|
||||
addControl('Load Asym Unit', () => loadAndSnapshot({ url: url, format: format, isBinary }));
|
||||
addControl('Load Assembly', () => loadAndSnapshot({ url: url, format: format, isBinary, assemblyId: assemblyId }));
|
||||
|
||||
addSeparator();
|
||||
|
||||
@@ -138,7 +144,7 @@
|
||||
// Same as "wheel icon" and Viewport options
|
||||
// addControl('Clip', () => PluginWrapper.viewport.setSettings({ clip: [33, 66] }));
|
||||
// addControl('Reset Clip', () => PluginWrapper.viewport.setSettings({ clip: [1, 100] }));
|
||||
|
||||
|
||||
addSeparator();
|
||||
|
||||
addHeader('Animation');
|
||||
@@ -171,7 +177,7 @@
|
||||
addControl('Init', () => PluginWrapper.experimentalData.init($('volume-streaming-wrapper')));
|
||||
addControl('Remove', () => PluginWrapper.experimentalData.remove());
|
||||
|
||||
addSeparator();
|
||||
addSeparator();
|
||||
addHeader('State');
|
||||
|
||||
var snapshot;
|
||||
@@ -185,10 +191,10 @@
|
||||
PluginWrapper.snapshot.set(snapshot);
|
||||
});
|
||||
addControl('Download State', () => {
|
||||
snapshot = PluginWrapper.snapshot.download('molj');
|
||||
PluginWrapper.snapshot.download('molj');
|
||||
});
|
||||
addControl('Download Session', () => {
|
||||
snapshot = PluginWrapper.snapshot.download('molx');
|
||||
PluginWrapper.snapshot.download('molx');
|
||||
});
|
||||
|
||||
////////////////////////////////////////////////////////
|
||||
|
||||
@@ -5,35 +5,34 @@
|
||||
*/
|
||||
|
||||
import * as ReactDOM from 'react-dom';
|
||||
import { Canvas3DProps, DefaultCanvas3DParams } from '../../mol-canvas3d/canvas3d';
|
||||
import { createPlugin, DefaultPluginSpec } from '../../mol-plugin';
|
||||
import './index.html';
|
||||
import { PluginContext } from '../../mol-plugin/context';
|
||||
import { PluginCommands } from '../../mol-plugin/commands';
|
||||
import { StateTransforms } from '../../mol-plugin-state/transforms';
|
||||
import { Color } from '../../mol-util/color';
|
||||
import { PluginStateObject as PSO, PluginStateObject } from '../../mol-plugin-state/objects';
|
||||
import { AnimateModelIndex } from '../../mol-plugin-state/animation/built-in';
|
||||
import { StateBuilder, StateObject, StateSelection } from '../../mol-state';
|
||||
import { EvolutionaryConservation } from './annotation';
|
||||
import { LoadParams, SupportedFormats, RepresentationStyle, ModelInfo, StateElements } from './helpers';
|
||||
import { RxEventHelper } from '../../mol-util/rx-event-helper';
|
||||
import { volumeStreamingControls } from './ui/controls';
|
||||
import { PluginState } from '../../mol-plugin/state';
|
||||
import { Scheduler } from '../../mol-task';
|
||||
import { createProteopediaCustomTheme } from './coloring';
|
||||
import { MolScriptBuilder as MS } from '../../mol-script/language/builder';
|
||||
import { ColorNames } from '../../mol-util/color/names';
|
||||
import { InitVolumeStreaming, CreateVolumeStreamingInfo } from '../../mol-plugin/behavior/dynamic/volume-streaming/transformers';
|
||||
import { DefaultCanvas3DParams, Canvas3DProps } from '../../mol-canvas3d/canvas3d';
|
||||
import { createStructureRepresentationParams } from '../../mol-plugin-state/helpers/structure-representation-params';
|
||||
import { download } from '../../mol-util/download';
|
||||
import { getFormattedTime } from '../../mol-util/date';
|
||||
import { PluginStateObject, PluginStateObject as PSO } from '../../mol-plugin-state/objects';
|
||||
import { StateTransforms } from '../../mol-plugin-state/transforms';
|
||||
import { CreateVolumeStreamingInfo, InitVolumeStreaming } from '../../mol-plugin/behavior/dynamic/volume-streaming/transformers';
|
||||
import { PluginCommands } from '../../mol-plugin/commands';
|
||||
import { PluginContext } from '../../mol-plugin/context';
|
||||
import { PluginState } from '../../mol-plugin/state';
|
||||
import { MolScriptBuilder as MS } from '../../mol-script/language/builder';
|
||||
import { StateBuilder, StateObject, StateSelection } from '../../mol-state';
|
||||
import { Asset } from '../../mol-util/assets';
|
||||
import { Color } from '../../mol-util/color';
|
||||
import { ColorNames } from '../../mol-util/color/names';
|
||||
import { getFormattedTime } from '../../mol-util/date';
|
||||
import { download } from '../../mol-util/download';
|
||||
import { RxEventHelper } from '../../mol-util/rx-event-helper';
|
||||
import { EvolutionaryConservation } from './annotation';
|
||||
import { createProteopediaCustomTheme } from './coloring';
|
||||
import { LoadParams, ModelInfo, RepresentationStyle, StateElements, SupportedFormats } from './helpers';
|
||||
import './index.html';
|
||||
import { volumeStreamingControls } from './ui/controls';
|
||||
require('../../mol-plugin-ui/skin/light.scss');
|
||||
|
||||
class MolStarProteopediaWrapper {
|
||||
static VERSION_MAJOR = 5;
|
||||
static VERSION_MINOR = 4;
|
||||
static VERSION_MINOR = 5;
|
||||
|
||||
private _ev = RxEventHelper.create();
|
||||
|
||||
@@ -233,7 +232,6 @@ class MolStarProteopediaWrapper {
|
||||
await this.updateStyle(representationStyle);
|
||||
|
||||
this.loadedParams = { url, format, assemblyId };
|
||||
Scheduler.setImmediate(() => PluginCommands.Camera.Reset(this.plugin, { }));
|
||||
}
|
||||
|
||||
async updateStyle(style?: RepresentationStyle, partial?: boolean) {
|
||||
@@ -251,9 +249,7 @@ class MolStarProteopediaWrapper {
|
||||
toggleSpin() {
|
||||
if (!this.plugin.canvas3d) return;
|
||||
const trackball = this.plugin.canvas3d.props.trackball;
|
||||
const spinning = trackball.spin;
|
||||
PluginCommands.Canvas3D.SetSettings(this.plugin, { settings: { trackball: { ...trackball, spin: !trackball.spin } } });
|
||||
if (!spinning) PluginCommands.Camera.Reset(this.plugin, { });
|
||||
}
|
||||
|
||||
viewport = {
|
||||
@@ -407,7 +403,7 @@ class MolStarProteopediaWrapper {
|
||||
try {
|
||||
const data = await this.plugin.runTask(this.plugin.fetch({ url, type: 'binary' }));
|
||||
this.loadedParams = { ...this.emptyLoadedParams };
|
||||
await this.plugin.managers.snapshot.open(new File([data], `state.${type}`));
|
||||
return await this.plugin.managers.snapshot.open(new File([data], `state.${type}`));
|
||||
} catch (e) {
|
||||
console.log(e);
|
||||
}
|
||||
|
||||
@@ -4,29 +4,28 @@
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { ThemeDataContext } from '../../mol-theme/theme';
|
||||
import { ParamDefinition as PD } from '../../mol-util/param-definition';
|
||||
import { Color } from '../../mol-util/color';
|
||||
import { getPalette } from '../../mol-util/color/palette';
|
||||
import { ColorTheme, LocationColor } from '../../mol-theme/color';
|
||||
import { ScaleLegend, TableLegend } from '../../mol-util/legend';
|
||||
import { StructureElement, Bond } from '../../mol-model/structure';
|
||||
import { Location } from '../../mol-model/location';
|
||||
import { CellPackInfoProvider } from './property';
|
||||
import { distinctColors } from '../../mol-util/color/distinct';
|
||||
import { Hcl } from '../../mol-util/color/spaces/hcl';
|
||||
|
||||
import { ThemeDataContext } from '../../../mol-theme/theme';
|
||||
import { ParamDefinition as PD } from '../../../mol-util/param-definition';
|
||||
import { Color } from '../../../mol-util/color';
|
||||
import { getPalette } from '../../../mol-util/color/palette';
|
||||
import { ColorTheme, LocationColor } from '../../../mol-theme/color';
|
||||
import { ScaleLegend, TableLegend } from '../../../mol-util/legend';
|
||||
import { StructureElement, Bond } from '../../../mol-model/structure';
|
||||
import { Location } from '../../../mol-model/location';
|
||||
import { CellPackInfoProvider } from '../property';
|
||||
import { distinctColors } from '../../../mol-util/color/distinct';
|
||||
import { Hcl } from '../../../mol-util/color/spaces/hcl';
|
||||
|
||||
const DefaultColor = Color(0xCCCCCC);
|
||||
const Description = 'Gives every model in a CellPack packing a unique color similar to other models in the packing.';
|
||||
const Description = 'Gives every model in a CellPack packing a unique generated color similar to other models in the packing.';
|
||||
|
||||
export const CellPackColorThemeParams = {};
|
||||
export type CellPackColorThemeParams = typeof CellPackColorThemeParams
|
||||
export function getCellPackColorThemeParams(ctx: ThemeDataContext) {
|
||||
return CellPackColorThemeParams; // TODO return copy
|
||||
export const CellPackGenerateColorThemeParams = {};
|
||||
export type CellPackGenerateColorThemeParams = typeof CellPackGenerateColorThemeParams
|
||||
export function getCellPackGenerateColorThemeParams(ctx: ThemeDataContext) {
|
||||
return CellPackGenerateColorThemeParams; // TODO return copy
|
||||
}
|
||||
|
||||
export function CellPackColorTheme(ctx: ThemeDataContext, props: PD.Values<CellPackColorThemeParams>): ColorTheme<CellPackColorThemeParams> {
|
||||
export function CellPackGenerateColorTheme(ctx: ThemeDataContext, props: PD.Values<CellPackGenerateColorThemeParams>): ColorTheme<CellPackGenerateColorThemeParams> {
|
||||
let color: LocationColor;
|
||||
let legend: ScaleLegend | TableLegend | undefined;
|
||||
|
||||
@@ -34,7 +33,8 @@ export function CellPackColorTheme(ctx: ThemeDataContext, props: PD.Values<CellP
|
||||
|
||||
if (ctx.structure && info) {
|
||||
const colors = distinctColors(info.packingsCount);
|
||||
const hcl = Hcl.fromColor(Hcl(), colors[info.packingIndex]);
|
||||
let hcl = Hcl.fromColor(Hcl(), colors[info.packingIndex]);
|
||||
|
||||
const hue = [Math.max(0, hcl[0] - 35), Math.min(360, hcl[0] + 35)] as [number, number];
|
||||
|
||||
const { models } = ctx.structure.root;
|
||||
@@ -70,7 +70,7 @@ export function CellPackColorTheme(ctx: ThemeDataContext, props: PD.Values<CellP
|
||||
}
|
||||
|
||||
return {
|
||||
factory: CellPackColorTheme,
|
||||
factory: CellPackGenerateColorTheme,
|
||||
granularity: 'instance',
|
||||
color,
|
||||
props,
|
||||
@@ -79,13 +79,13 @@ export function CellPackColorTheme(ctx: ThemeDataContext, props: PD.Values<CellP
|
||||
};
|
||||
}
|
||||
|
||||
export const CellPackColorThemeProvider: ColorTheme.Provider<CellPackColorThemeParams, 'cellpack'> = {
|
||||
name: 'cellpack',
|
||||
label: 'CellPack',
|
||||
export const CellPackGenerateColorThemeProvider: ColorTheme.Provider<CellPackGenerateColorThemeParams, 'cellpack-generate'> = {
|
||||
name: 'cellpack-generate',
|
||||
label: 'CellPack Generate',
|
||||
category: ColorTheme.Category.Chain,
|
||||
factory: CellPackColorTheme,
|
||||
getParams: getCellPackColorThemeParams,
|
||||
defaultValues: PD.getDefaultValues(CellPackColorThemeParams),
|
||||
factory: CellPackGenerateColorTheme,
|
||||
getParams: getCellPackGenerateColorThemeParams,
|
||||
defaultValues: PD.getDefaultValues(CellPackGenerateColorThemeParams),
|
||||
isApplicable: (ctx: ThemeDataContext) => {
|
||||
return (
|
||||
!!ctx.structure && ctx.structure.elementCount > 0 &&
|
||||
@@ -93,4 +93,5 @@ export const CellPackColorThemeProvider: ColorTheme.Provider<CellPackColorThemeP
|
||||
!!CellPackInfoProvider.get(ctx.structure).value
|
||||
);
|
||||
}
|
||||
};
|
||||
};
|
||||
|
||||
72
src/extensions/cellpack/color/provided.ts
Normal file
72
src/extensions/cellpack/color/provided.ts
Normal file
@@ -0,0 +1,72 @@
|
||||
/**
|
||||
* Copyright (c) 2020 mol* contributors, licensed under MIT, See LICENSE file for more info.
|
||||
*
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { ThemeDataContext } from '../../../mol-theme/theme';
|
||||
import { ParamDefinition as PD } from '../../../mol-util/param-definition';
|
||||
import { Color } from '../../../mol-util/color';
|
||||
import { ColorTheme, LocationColor } from '../../../mol-theme/color';
|
||||
import { ScaleLegend, TableLegend } from '../../../mol-util/legend';
|
||||
import { StructureElement } from '../../../mol-model/structure';
|
||||
import { Location } from '../../../mol-model/location';
|
||||
import { CellPackInfoProvider } from '../property';
|
||||
|
||||
const DefaultColor = Color(0xCCCCCC);
|
||||
const Description = 'Gives every model in a CellPack the color provied in the packing data.';
|
||||
|
||||
export const CellPackProvidedColorThemeParams = {};
|
||||
export type CellPackProvidedColorThemeParams = typeof CellPackProvidedColorThemeParams
|
||||
export function getCellPackProvidedColorThemeParams(ctx: ThemeDataContext) {
|
||||
return CellPackProvidedColorThemeParams; // TODO return copy
|
||||
}
|
||||
|
||||
export function CellPackProvidedColorTheme(ctx: ThemeDataContext, props: PD.Values<CellPackProvidedColorThemeParams>): ColorTheme<CellPackProvidedColorThemeParams> {
|
||||
let color: LocationColor;
|
||||
let legend: ScaleLegend | TableLegend | undefined;
|
||||
|
||||
const info = ctx.structure && CellPackInfoProvider.get(ctx.structure).value;
|
||||
|
||||
if (ctx.structure && info?.colors) {
|
||||
const { models } = ctx.structure.root;
|
||||
const modelColor = new Map<number, Color>();
|
||||
for (let i = 0, il = models.length; i < il; ++i) {
|
||||
const idx = models[i].trajectoryInfo.index;
|
||||
modelColor.set(models[i].trajectoryInfo.index, info.colors[idx]);
|
||||
}
|
||||
|
||||
color = (location: Location): Color => {
|
||||
return StructureElement.Location.is(location)
|
||||
? modelColor.get(location.unit.model.trajectoryInfo.index)!
|
||||
: DefaultColor;
|
||||
};
|
||||
} else {
|
||||
color = () => DefaultColor;
|
||||
}
|
||||
|
||||
return {
|
||||
factory: CellPackProvidedColorTheme,
|
||||
granularity: 'instance',
|
||||
color,
|
||||
props,
|
||||
description: Description,
|
||||
legend
|
||||
};
|
||||
}
|
||||
|
||||
export const CellPackProvidedColorThemeProvider: ColorTheme.Provider<CellPackProvidedColorThemeParams, 'cellpack-provided'> = {
|
||||
name: 'cellpack-provided',
|
||||
label: 'CellPack Provided',
|
||||
category: ColorTheme.Category.Chain,
|
||||
factory: CellPackProvidedColorTheme,
|
||||
getParams: getCellPackProvidedColorThemeParams,
|
||||
defaultValues: PD.getDefaultValues(CellPackProvidedColorThemeParams),
|
||||
isApplicable: (ctx: ThemeDataContext) => {
|
||||
return (
|
||||
!!ctx.structure && ctx.structure.elementCount > 0 &&
|
||||
ctx.structure.models[0].trajectoryInfo.size > 1 &&
|
||||
!!CellPackInfoProvider.get(ctx.structure).value?.colors
|
||||
);
|
||||
}
|
||||
};
|
||||
@@ -191,8 +191,14 @@ function GetMiniFrame(points: Vec3[], normals: Vec3[]) {
|
||||
|
||||
const rpTmpVec1 = Vec3();
|
||||
|
||||
export function getMatFromResamplePoints(points: NumberArray, segmentLength: number) {
|
||||
const new_points = ResampleControlPoints(points, segmentLength);
|
||||
export function getMatFromResamplePoints(points: NumberArray, segmentLength: number, resample: boolean) {
|
||||
let new_points: Vec3[] = [];
|
||||
if (resample) new_points = ResampleControlPoints(points, segmentLength);
|
||||
else {
|
||||
for (let idx = 0; idx < points.length / 3; ++idx){
|
||||
new_points.push(Vec3.fromArray(Vec3.zero(), points, idx * 3));
|
||||
}
|
||||
}
|
||||
const npoints = new_points.length;
|
||||
const new_normal = GetSmoothNormals(new_points);
|
||||
const frames = GetMiniFrame(new_points, new_normal);
|
||||
|
||||
@@ -59,6 +59,7 @@ export interface Ingredient {
|
||||
radii?: [Radii];
|
||||
/** Number of `curveX` properties in the object where `X` is a 0-indexed number */
|
||||
nbCurve?: number;
|
||||
uLength?: number;
|
||||
/** Curve properties are Vec3[] but that is not expressable in TypeScript */
|
||||
[curveX: string]: unknown;
|
||||
/** the orientation in the membrane */
|
||||
@@ -66,6 +67,8 @@ export interface Ingredient {
|
||||
/** offset along membrane */
|
||||
offset?: Vec3;
|
||||
ingtype?: string;
|
||||
color?: Vec3;
|
||||
confidence?: number;
|
||||
}
|
||||
|
||||
export interface IngredientSource {
|
||||
|
||||
@@ -5,9 +5,9 @@
|
||||
*/
|
||||
|
||||
import { PluginBehavior } from '../../mol-plugin/behavior';
|
||||
import { CellPackColorThemeProvider } from './color';
|
||||
import { LoadCellPackModel } from './model';
|
||||
|
||||
import { CellPackGenerateColorThemeProvider } from './color/generate';
|
||||
import { CellPackProvidedColorThemeProvider } from './color/provided';
|
||||
|
||||
export const CellPack = PluginBehavior.create<{ autoAttach: boolean, showTooltip: boolean }>({
|
||||
name: 'cellpack',
|
||||
@@ -19,12 +19,14 @@ export const CellPack = PluginBehavior.create<{ autoAttach: boolean, showTooltip
|
||||
ctor: class extends PluginBehavior.Handler<{ autoAttach: boolean, showTooltip: boolean }> {
|
||||
register(): void {
|
||||
this.ctx.state.data.actions.add(LoadCellPackModel);
|
||||
this.ctx.representation.structure.themes.colorThemeRegistry.add(CellPackColorThemeProvider);
|
||||
this.ctx.representation.structure.themes.colorThemeRegistry.add(CellPackGenerateColorThemeProvider);
|
||||
this.ctx.representation.structure.themes.colorThemeRegistry.add(CellPackProvidedColorThemeProvider);
|
||||
}
|
||||
|
||||
unregister() {
|
||||
this.ctx.state.data.actions.remove(LoadCellPackModel);
|
||||
this.ctx.representation.structure.themes.colorThemeRegistry.remove(CellPackColorThemeProvider);
|
||||
this.ctx.representation.structure.themes.colorThemeRegistry.remove(CellPackGenerateColorThemeProvider);
|
||||
this.ctx.representation.structure.themes.colorThemeRegistry.remove(CellPackProvidedColorThemeProvider);
|
||||
}
|
||||
}
|
||||
});
|
||||
@@ -17,7 +17,7 @@ import { Mat4, Vec3, Quat } from '../../mol-math/linear-algebra';
|
||||
import { SymmetryOperator } from '../../mol-math/geometry';
|
||||
import { Task, RuntimeContext } from '../../mol-task';
|
||||
import { StateTransforms } from '../../mol-plugin-state/transforms';
|
||||
import { ParseCellPack, StructureFromCellpack, DefaultCellPackBaseUrl } from './state';
|
||||
import { ParseCellPack, StructureFromCellpack, DefaultCellPackBaseUrl, StructureFromAssemblies } from './state';
|
||||
import { MolScriptBuilder as MS } from '../../mol-script/language/builder';
|
||||
import { getMatFromResamplePoints } from './curve';
|
||||
import { compile } from '../../mol-script/runtime/query/compiler';
|
||||
@@ -27,61 +27,76 @@ import { Column } from '../../mol-data/db';
|
||||
import { createModels } from '../../mol-model-formats/structure/basic/parser';
|
||||
import { CellpackPackingPreset, CellpackMembranePreset } from './preset';
|
||||
import { Asset } from '../../mol-util/assets';
|
||||
import { Color } from '../../mol-util/color';
|
||||
import { readFromFile } from '../../mol-util/data-source';
|
||||
import { objectForEach } from '../../mol-util/object';
|
||||
|
||||
function getCellPackModelUrl(fileName: string, baseUrl: string) {
|
||||
return `${baseUrl}/results/${fileName}`;
|
||||
}
|
||||
|
||||
async function getModel(plugin: PluginContext, id: string, ingredient: Ingredient, baseUrl: string, file?: Asset.File) {
|
||||
class TrajectoryCache {
|
||||
private map = new Map<string, Model.Trajectory>();
|
||||
set(id: string, trajectory: Model.Trajectory) { this.map.set(id, trajectory); }
|
||||
get(id: string) { return this.map.get(id); }
|
||||
}
|
||||
|
||||
async function getModel(plugin: PluginContext, id: string, ingredient: Ingredient, baseUrl: string, trajCache: TrajectoryCache, file?: Asset.File) {
|
||||
const assetManager = plugin.managers.asset;
|
||||
const model_id = (ingredient.source.model) ? parseInt(ingredient.source.model) : 0;
|
||||
const modelIndex = (ingredient.source.model) ? parseInt(ingredient.source.model) : 0;
|
||||
const surface = (ingredient.ingtype) ? (ingredient.ingtype === 'transmembrane') : false;
|
||||
let model: Model;
|
||||
let trajectory = trajCache.get(id);
|
||||
let assets: Asset.Wrapper[] = [];
|
||||
if (file) {
|
||||
if (file.name.endsWith('.cif')) {
|
||||
const text = await plugin.runTask(assetManager.resolve(file, 'string'));
|
||||
assets.push(text);
|
||||
const cif = (await parseCif(plugin, text.data)).blocks[0];
|
||||
model = (await plugin.runTask(trajectoryFromMmCIF(cif)))[model_id];
|
||||
} else if (file.name.endsWith('.bcif')) {
|
||||
const binary = await plugin.runTask(assetManager.resolve(file, 'binary'));
|
||||
assets.push(binary);
|
||||
const cif = (await parseCif(plugin, binary.data)).blocks[0];
|
||||
model = (await plugin.runTask(trajectoryFromMmCIF(cif)))[model_id];
|
||||
} else if (file.name.endsWith('.pdb')) {
|
||||
const text = await plugin.runTask(assetManager.resolve(file, 'string'));
|
||||
assets.push(text);
|
||||
const pdb = await parsePDBfile(plugin, text.data, id);
|
||||
model = (await plugin.runTask(trajectoryFromPDB(pdb)))[model_id];
|
||||
} else {
|
||||
throw new Error(`unsupported file type '${file.name}'`);
|
||||
}
|
||||
} else if (id.match(/^[1-9][a-zA-Z0-9]{3,3}$/i)) {
|
||||
if (surface){
|
||||
const data = await getFromOPM(plugin, id, assetManager);
|
||||
if (data.asset){
|
||||
assets.push(data.asset);
|
||||
model = (await plugin.runTask(trajectoryFromPDB(data.pdb)))[model_id];
|
||||
if (!trajectory) {
|
||||
if (file) {
|
||||
if (file.name.endsWith('.cif')) {
|
||||
const text = await plugin.runTask(assetManager.resolve(file, 'string'));
|
||||
assets.push(text);
|
||||
const cif = (await parseCif(plugin, text.data)).blocks[0];
|
||||
trajectory = await plugin.runTask(trajectoryFromMmCIF(cif));
|
||||
} else if (file.name.endsWith('.bcif')) {
|
||||
const binary = await plugin.runTask(assetManager.resolve(file, 'binary'));
|
||||
assets.push(binary);
|
||||
const cif = (await parseCif(plugin, binary.data)).blocks[0];
|
||||
trajectory = await plugin.runTask(trajectoryFromMmCIF(cif));
|
||||
} else if (file.name.endsWith('.pdb')) {
|
||||
const text = await plugin.runTask(assetManager.resolve(file, 'string'));
|
||||
assets.push(text);
|
||||
const pdb = await parsePDBfile(plugin, text.data, id);
|
||||
trajectory = await plugin.runTask(trajectoryFromPDB(pdb));
|
||||
} else {
|
||||
throw new Error(`unsupported file type '${file.name}'`);
|
||||
}
|
||||
} else if (id.match(/^[1-9][a-zA-Z0-9]{3,3}$/i)) {
|
||||
if (surface){
|
||||
try {
|
||||
const data = await getFromOPM(plugin, id, assetManager);
|
||||
assets.push(data.asset);
|
||||
trajectory = await plugin.runTask(trajectoryFromPDB(data.pdb));
|
||||
} catch (e) {
|
||||
// fallback to getFromPdb
|
||||
// console.error(e);
|
||||
const { mmcif, asset } = await getFromPdb(plugin, id, assetManager);
|
||||
assets.push(asset);
|
||||
trajectory = await plugin.runTask(trajectoryFromMmCIF(mmcif));
|
||||
}
|
||||
} else {
|
||||
const { mmcif, asset } = await getFromPdb(plugin, id, assetManager);
|
||||
assets.push(asset);
|
||||
model = (await plugin.runTask(trajectoryFromMmCIF(mmcif)))[model_id];
|
||||
trajectory = await plugin.runTask(trajectoryFromMmCIF(mmcif));
|
||||
}
|
||||
} else {
|
||||
const { mmcif, asset } = await getFromPdb(plugin, id, assetManager);
|
||||
assets.push(asset);
|
||||
model = (await plugin.runTask(trajectoryFromMmCIF(mmcif)))[model_id];
|
||||
}
|
||||
} else {
|
||||
const data = await getFromCellPackDB(plugin, id, baseUrl, assetManager);
|
||||
assets.push(data.asset);
|
||||
if ('pdb' in data) {
|
||||
model = (await plugin.runTask(trajectoryFromPDB(data.pdb)))[model_id];
|
||||
} else {
|
||||
model = (await plugin.runTask(trajectoryFromMmCIF(data.mmcif)))[model_id];
|
||||
const data = await getFromCellPackDB(plugin, id, baseUrl, assetManager);
|
||||
assets.push(data.asset);
|
||||
if ('pdb' in data) {
|
||||
trajectory = await plugin.runTask(trajectoryFromPDB(data.pdb));
|
||||
} else {
|
||||
trajectory = await plugin.runTask(trajectoryFromMmCIF(data.mmcif));
|
||||
}
|
||||
}
|
||||
trajCache.set(id, trajectory);
|
||||
}
|
||||
const model = trajectory[modelIndex];
|
||||
return { model, assets };
|
||||
}
|
||||
|
||||
@@ -94,7 +109,7 @@ async function getStructure(plugin: PluginContext, model: Model, source: Ingredi
|
||||
}
|
||||
let query;
|
||||
if (source.selection){
|
||||
const asymIds: string[] = source.selection.replace(' :', '').split(' or');
|
||||
const asymIds: string[] = source.selection.replace(' ', '').replace(':', '').split('or');
|
||||
query = MS.struct.modifier.union([
|
||||
MS.struct.generator.atomGroups({
|
||||
'entity-test': MS.core.rel.eq([MS.ammp('entityType'), 'polymer']),
|
||||
@@ -133,7 +148,6 @@ function getTransform(trans: Vec3, rot: Quat) {
|
||||
return m;
|
||||
}
|
||||
|
||||
|
||||
function getResultTransforms(results: Ingredient['results'], legacy: boolean) {
|
||||
if (legacy) return results.map((r: Ingredient['results'][0]) => getTransformLegacy(r[0], r[1]));
|
||||
else return results.map((r: Ingredient['results'][0]) => getTransform(r[0], r[1]));
|
||||
@@ -142,11 +156,15 @@ function getResultTransforms(results: Ingredient['results'], legacy: boolean) {
|
||||
function getCurveTransforms(ingredient: Ingredient) {
|
||||
const n = ingredient.nbCurve || 0;
|
||||
const instances: Mat4[] = [];
|
||||
const segmentLength = ingredient.radii
|
||||
? (ingredient.radii[0].radii
|
||||
let segmentLength = 3.4;
|
||||
if (ingredient.uLength){
|
||||
segmentLength = ingredient.uLength;
|
||||
} else if (ingredient.radii){
|
||||
segmentLength = ingredient.radii[0].radii
|
||||
? ingredient.radii[0].radii[0] * 2.0
|
||||
: 3.4)
|
||||
: 3.4;
|
||||
: 3.4;
|
||||
}
|
||||
let resampling: boolean = false;
|
||||
for (let i = 0; i < n; ++i) {
|
||||
const cname = `curve${i}`;
|
||||
if (!(cname in ingredient)) {
|
||||
@@ -158,12 +176,17 @@ function getCurveTransforms(ingredient: Ingredient) {
|
||||
// TODO handle curve with 2 or less points
|
||||
continue;
|
||||
}
|
||||
// test for resampling
|
||||
let distance: number = Vec3.distance(_points[0], _points[1]);
|
||||
if (distance >= segmentLength + 2.0) {
|
||||
console.info(distance);
|
||||
resampling = true;
|
||||
}
|
||||
const points = new Float32Array(_points.length * 3);
|
||||
for (let i = 0, il = _points.length; i < il; ++i) Vec3.toArray(_points[i], points, i * 3);
|
||||
const newInstances = getMatFromResamplePoints(points, segmentLength);
|
||||
const newInstances = getMatFromResamplePoints(points, segmentLength, resampling);
|
||||
instances.push(...newInstances);
|
||||
}
|
||||
|
||||
return instances;
|
||||
}
|
||||
|
||||
@@ -277,7 +300,6 @@ function getCifCurve(name: string, transforms: Mat4[], model: Model) {
|
||||
|
||||
async function getCurve(plugin: PluginContext, name: string, ingredient: Ingredient, transforms: Mat4[], model: Model) {
|
||||
const cif = getCifCurve(name, transforms, model);
|
||||
|
||||
const curveModelTask = Task.create('Curve Model', async ctx => {
|
||||
const format = MmcifFormat.fromFrame(cif);
|
||||
const models = await createModels(format.data.db, format, ctx);
|
||||
@@ -288,22 +310,22 @@ async function getCurve(plugin: PluginContext, name: string, ingredient: Ingredi
|
||||
return getStructure(plugin, curveModel, ingredient.source);
|
||||
}
|
||||
|
||||
async function getIngredientStructure(plugin: PluginContext, ingredient: Ingredient, baseUrl: string, ingredientFiles: IngredientFiles) {
|
||||
async function getIngredientStructure(plugin: PluginContext, ingredient: Ingredient, baseUrl: string, ingredientFiles: IngredientFiles, trajCache: TrajectoryCache) {
|
||||
const { name, source, results, nbCurve } = ingredient;
|
||||
if (source.pdb === 'None') return;
|
||||
|
||||
const file = ingredientFiles[source.pdb];
|
||||
if (!file) {
|
||||
// TODO can these be added to the library?
|
||||
if (name === 'HIV1_CAhex_0_1_0') return;
|
||||
if (name === 'HIV1_CAhexCyclophilA_0_1_0') return;
|
||||
if (name === 'iLDL') return;
|
||||
if (name === 'peptides') return;
|
||||
if (name === 'HIV1_CAhex_0_1_0') return; // 1VU4CtoH_hex.pdb
|
||||
if (name === 'HIV1_CAhexCyclophilA_0_1_0') return; // 1AK4fitTo1VU4hex.pdb
|
||||
if (name === 'iLDL') return; // EMD-5239
|
||||
if (name === 'peptides') return; // peptide.pdb
|
||||
if (name === 'lypoglycane') return;
|
||||
}
|
||||
|
||||
// model id in case structure is NMR
|
||||
const { model, assets } = await getModel(plugin, source.pdb || name, ingredient, baseUrl, file);
|
||||
const { model, assets } = await getModel(plugin, source.pdb || name, ingredient, baseUrl, trajCache, file);
|
||||
if (!model) return;
|
||||
|
||||
let structure: Structure;
|
||||
@@ -354,13 +376,22 @@ export function createStructureFromCellPack(plugin: PluginContext, packing: Cell
|
||||
return Task.create('Create Packing Structure', async ctx => {
|
||||
const { ingredients, name } = packing;
|
||||
const assets: Asset.Wrapper[] = [];
|
||||
const trajCache = new TrajectoryCache();
|
||||
const structures: Structure[] = [];
|
||||
const colors: Color[] = [];
|
||||
let skipColors: boolean = false;
|
||||
for (const iName in ingredients) {
|
||||
if (ctx.shouldUpdate) await ctx.update(iName);
|
||||
const ingredientStructure = await getIngredientStructure(plugin, ingredients[iName], baseUrl, ingredientFiles);
|
||||
const ingredientStructure = await getIngredientStructure(plugin, ingredients[iName], baseUrl, ingredientFiles, trajCache);
|
||||
if (ingredientStructure) {
|
||||
structures.push(ingredientStructure.structure);
|
||||
assets.push(...ingredientStructure.assets);
|
||||
const c = ingredients[iName].color;
|
||||
if (c){
|
||||
colors.push(Color.fromNormalizedRgb(c[0], c[1], c[2]));
|
||||
} else {
|
||||
skipColors = true;
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
@@ -385,7 +416,7 @@ export function createStructureFromCellPack(plugin: PluginContext, packing: Cell
|
||||
trajectoryInfo.size = il;
|
||||
trajectoryInfo.index = i;
|
||||
}
|
||||
return { structure, assets };
|
||||
return { structure, assets, colors: skipColors ? undefined : colors };
|
||||
});
|
||||
}
|
||||
|
||||
@@ -421,11 +452,25 @@ async function loadMembrane(plugin: PluginContext, name: string, state: State, p
|
||||
break;
|
||||
}
|
||||
}
|
||||
if (!file){
|
||||
// check for cif directly
|
||||
const cifileName = `${name}.cif`;
|
||||
for (const f of params.ingredients.files) {
|
||||
if (cifileName === f.name) {
|
||||
file = f;
|
||||
break;
|
||||
}
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
let b = state.build().toRoot();
|
||||
if (file) {
|
||||
b = b.apply(StateTransforms.Data.ReadFile, { file, isBinary: true, label: file.name }, { state: { isGhost: true } });
|
||||
if (file.name.endsWith('.cif')) {
|
||||
b = b.apply(StateTransforms.Data.ReadFile, { file, isBinary: false, label: file.name }, { state: { isGhost: true } });
|
||||
} else if (file.name.endsWith('.bcif')) {
|
||||
b = b.apply(StateTransforms.Data.ReadFile, { file, isBinary: true, label: file.name }, { state: { isGhost: true } });
|
||||
}
|
||||
} else {
|
||||
const url = Asset.getUrlAsset(plugin.managers.asset, `${params.baseUrl}/membranes/${name}.bcif`);
|
||||
b = b.apply(StateTransforms.Data.Download, { url, isBinary: true, label: name }, { state: { isGhost: true } });
|
||||
@@ -434,16 +479,19 @@ async function loadMembrane(plugin: PluginContext, name: string, state: State, p
|
||||
const membrane = await b.apply(StateTransforms.Data.ParseCif, undefined, { state: { isGhost: true } })
|
||||
.apply(StateTransforms.Model.TrajectoryFromMmCif, undefined, { state: { isGhost: true } })
|
||||
.apply(StateTransforms.Model.ModelFromTrajectory, undefined, { state: { isGhost: true } })
|
||||
.apply(StateTransforms.Model.StructureFromModel)
|
||||
.apply(StructureFromAssemblies, undefined, { state: { isGhost: true } })
|
||||
.commit({ revertOnError: true });
|
||||
|
||||
const membraneParams = {
|
||||
representation: params.preset.representation,
|
||||
};
|
||||
|
||||
await CellpackMembranePreset.apply(membrane, membraneParams, plugin);
|
||||
}
|
||||
|
||||
async function loadPackings(plugin: PluginContext, runtime: RuntimeContext, state: State, params: LoadCellPackModelParams) {
|
||||
const ingredientFiles = params.ingredients.files || [];
|
||||
|
||||
let cellPackJson: StateBuilder.To<PSO.Format.Json, StateTransformer<PSO.Data.String, PSO.Format.Json>>;
|
||||
if (params.source.name === 'id') {
|
||||
const url = Asset.getUrlAsset(plugin.managers.asset, getCellPackModelUrl(params.source.params, params.baseUrl));
|
||||
@@ -451,12 +499,25 @@ async function loadPackings(plugin: PluginContext, runtime: RuntimeContext, stat
|
||||
.apply(StateTransforms.Data.Download, { url, isBinary: false, label: params.source.params }, { state: { isGhost: true } });
|
||||
} else {
|
||||
const file = params.source.params;
|
||||
if (file === null) {
|
||||
if (!file?.file) {
|
||||
plugin.log.error('No file selected');
|
||||
return;
|
||||
}
|
||||
|
||||
let jsonFile: Asset.File;
|
||||
if (file.name.toLowerCase().endsWith('.zip')) {
|
||||
const data = await readFromFile(file.file, 'zip').runInContext(runtime);
|
||||
jsonFile = Asset.File(new File([data['model.json']], 'model.json'));
|
||||
objectForEach(data, (v, k) => {
|
||||
if (k === 'model.json') return;
|
||||
ingredientFiles.push(Asset.File(new File([v], k)));
|
||||
});
|
||||
} else {
|
||||
jsonFile = file;
|
||||
}
|
||||
|
||||
cellPackJson = state.build().toRoot()
|
||||
.apply(StateTransforms.Data.ReadFile, { file, isBinary: false, label: file.name }, { state: { isGhost: true } });
|
||||
.apply(StateTransforms.Data.ReadFile, { file: jsonFile, isBinary: false, label: jsonFile.name }, { state: { isGhost: true } });
|
||||
}
|
||||
|
||||
const cellPackBuilder = cellPackJson
|
||||
@@ -469,7 +530,7 @@ async function loadPackings(plugin: PluginContext, runtime: RuntimeContext, stat
|
||||
await handleHivRna(plugin, packings, params.baseUrl);
|
||||
|
||||
for (let i = 0, il = packings.length; i < il; ++i) {
|
||||
const p = { packing: i, baseUrl: params.baseUrl, ingredientFiles: params.ingredients.files };
|
||||
const p = { packing: i, baseUrl: params.baseUrl, ingredientFiles };
|
||||
|
||||
const packing = await state.build()
|
||||
.to(cellPackBuilder.ref)
|
||||
@@ -481,7 +542,7 @@ async function loadPackings(plugin: PluginContext, runtime: RuntimeContext, stat
|
||||
representation: params.preset.representation,
|
||||
};
|
||||
await CellpackPackingPreset.apply(packing, packingParams, plugin);
|
||||
if ( packings[i].location === 'surface' ){
|
||||
if ( packings[i].location === 'surface' && params.membrane){
|
||||
await loadMembrane(plugin, packings[i].name, state, params);
|
||||
}
|
||||
}
|
||||
@@ -489,18 +550,21 @@ async function loadPackings(plugin: PluginContext, runtime: RuntimeContext, stat
|
||||
|
||||
const LoadCellPackModelParams = {
|
||||
source: PD.MappedStatic('id', {
|
||||
'id': PD.Select('influenza_model1.json', [
|
||||
['blood_hiv_immature_inside.json', 'blood_hiv_immature_inside'],
|
||||
['BloodHIV1.0_mixed_fixed_nc1.cpr', 'BloodHIV1.0_mixed_fixed_nc1'],
|
||||
['HIV-1_0.1.6-8_mixed_radii_pdb.cpr', 'HIV-1_0.1.6-8_mixed_radii_pdb'],
|
||||
['hiv_lipids.bcif', 'hiv_lipids'],
|
||||
['influenza_model1.json', 'influenza_model1'],
|
||||
['ExosomeModel.json', 'ExosomeModel'],
|
||||
['Mycoplasma1.5_mixed_pdb_fixed.cpr', 'Mycoplasma1.5_mixed_pdb_fixed'],
|
||||
] as const),
|
||||
'file': PD.File({ accept: 'id' }),
|
||||
'id': PD.Select('InfluenzaModel2.json', [
|
||||
['blood_hiv_immature_inside.json', 'Blood HIV immature'],
|
||||
['HIV_immature_model.json', 'HIV immature'],
|
||||
['BloodHIV1.0_mixed_fixed_nc1.cpr', 'Blood HIV'],
|
||||
['HIV-1_0.1.6-8_mixed_radii_pdb.cpr', 'HIV'],
|
||||
['influenza_model1.json', 'Influenza envelope'],
|
||||
['InfluenzaModel2.json', 'Influenza Complete'],
|
||||
['ExosomeModel.json', 'Exosome Model'],
|
||||
['Mycoplasma1.5_mixed_pdb_fixed.cpr', 'Mycoplasma simple'],
|
||||
['MycoplasmaModel.json', 'Mycoplasma WholeCell model'],
|
||||
] as const, { description: 'Download the model definition with `id` from the server at `baseUrl.`' }),
|
||||
'file': PD.File({ accept: '.json,.cpr,.zip', description: 'Open model definition from .json/.cpr file or open .zip file containing model definition plus ingredients.' }),
|
||||
}, { options: [['id', 'Id'], ['file', 'File']] }),
|
||||
baseUrl: PD.Text(DefaultCellPackBaseUrl),
|
||||
membrane: PD.Boolean(true),
|
||||
ingredients : PD.Group({
|
||||
files: PD.FileList({ accept: '.cif,.bcif,.pdb' })
|
||||
}, { isExpanded: true }),
|
||||
@@ -516,9 +580,5 @@ export const LoadCellPackModel = StateAction.build({
|
||||
params: LoadCellPackModelParams,
|
||||
from: PSO.Root
|
||||
})(({ state, params }, ctx: PluginContext) => Task.create('CellPack Loader', async taskCtx => {
|
||||
if (params.source.name === 'id' && params.source.params === 'hiv_lipids.bcif') {
|
||||
await loadMembrane(ctx, 'hiv_lipids', state, params);
|
||||
} else {
|
||||
await loadPackings(ctx, taskCtx, state, params);
|
||||
}
|
||||
await loadPackings(ctx, taskCtx, state, params);
|
||||
}));
|
||||
@@ -8,7 +8,9 @@ import { StateObjectRef } from '../../mol-state';
|
||||
import { StructureRepresentationPresetProvider, presetStaticComponent } from '../../mol-plugin-state/builder/structure/representation-preset';
|
||||
import { ParamDefinition as PD } from '../../mol-util/param-definition';
|
||||
import { ColorNames } from '../../mol-util/color/names';
|
||||
import { CellPackColorThemeProvider } from './color';
|
||||
import { CellPackGenerateColorThemeProvider } from './color/generate';
|
||||
import { CellPackInfoProvider } from './property';
|
||||
import { CellPackProvidedColorThemeProvider } from './color/provided';
|
||||
|
||||
export const CellpackPackingPresetParams = {
|
||||
traceOnly: PD.Boolean(true),
|
||||
@@ -40,8 +42,10 @@ export const CellpackPackingPreset = StructureRepresentationPresetProvider({
|
||||
Object.assign(reprProps, { sizeFactor: 2 });
|
||||
}
|
||||
|
||||
const info = structureCell.obj?.data && CellPackInfoProvider.get(structureCell.obj?.data).value;
|
||||
const color = info?.colors ? CellPackProvidedColorThemeProvider.name : CellPackGenerateColorThemeProvider.name;
|
||||
|
||||
const { update, builder, typeParams } = StructureRepresentationPresetProvider.reprBuilder(plugin, {});
|
||||
const color = CellPackColorThemeProvider.name;
|
||||
const representations = {
|
||||
polymer: builder.buildRepresentation<any>(update, components.polymer, { type: params.representation, typeParams: { ...typeParams, ...reprProps }, color }, { tag: 'polymer' })
|
||||
};
|
||||
@@ -85,6 +89,7 @@ export const CellpackMembranePreset = StructureRepresentationPresetProvider({
|
||||
};
|
||||
|
||||
await update.commit({ revertOnError: true });
|
||||
|
||||
return { components, representations };
|
||||
}
|
||||
});
|
||||
@@ -5,17 +5,20 @@
|
||||
*/
|
||||
|
||||
import { CustomStructureProperty } from '../../mol-model-props/common/custom-structure-property';
|
||||
import { Structure, CustomPropertyDescriptor } from '../../mol-model/structure';
|
||||
import { Structure } from '../../mol-model/structure';
|
||||
import { CustomProperty } from '../../mol-model-props/common/custom-property';
|
||||
import { ParamDefinition as PD } from '../../mol-util/param-definition';
|
||||
import { Color } from '../../mol-util/color';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/custom-property';
|
||||
|
||||
export type CellPackInfoValue = {
|
||||
packingsCount: number
|
||||
packingIndex: number
|
||||
colors?: Color[]
|
||||
}
|
||||
|
||||
const CellPackInfoParams = {
|
||||
info: PD.Value<CellPackInfoValue>({ packingsCount: 1, packingIndex: 0 }, { isHidden: true })
|
||||
info: PD.Value<CellPackInfoValue>({ packingsCount: 1, packingIndex: 0, colors: undefined }, { isHidden: true })
|
||||
};
|
||||
type CellPackInfoParams = PD.Values<typeof CellPackInfoParams>
|
||||
|
||||
|
||||
@@ -13,6 +13,8 @@ import { IngredientFiles } from './util';
|
||||
import { Asset } from '../../mol-util/assets';
|
||||
import { PluginContext } from '../../mol-plugin/context';
|
||||
import { CellPackInfoProvider } from './property';
|
||||
import { Structure, StructureSymmetry, Unit } from '../../mol-model/structure';
|
||||
import { ModelSymmetry } from '../../mol-model-formats/structure/property/symmetry';
|
||||
|
||||
export const DefaultCellPackBaseUrl = 'https://mesoscope.scripps.edu/data/cellPACK_data/cellPACK_database_1.1.0/';
|
||||
|
||||
@@ -71,10 +73,9 @@ const StructureFromCellpack = PluginStateTransform.BuiltIn({
|
||||
ingredientFiles[file.name] = file;
|
||||
}
|
||||
}
|
||||
const { structure, assets } = await createStructureFromCellPack(plugin, packing, params.baseUrl, ingredientFiles).runInContext(ctx);
|
||||
|
||||
const { structure, assets, colors } = await createStructureFromCellPack(plugin, packing, params.baseUrl, ingredientFiles).runInContext(ctx);
|
||||
await CellPackInfoProvider.attach({ runtime: ctx, assetManager: plugin.managers.asset }, structure, {
|
||||
info: { packingsCount: a.data.packings.length, packingIndex: params.packing }
|
||||
info: { packingsCount: a.data.packings.length, packingIndex: params.packing, colors }
|
||||
});
|
||||
|
||||
(cache as any).assets = assets;
|
||||
@@ -94,4 +95,110 @@ const StructureFromCellpack = PluginStateTransform.BuiltIn({
|
||||
}
|
||||
}
|
||||
}
|
||||
});
|
||||
});
|
||||
|
||||
export { StructureFromAssemblies };
|
||||
type StructureFromAssemblies = typeof StructureFromAssemblies
|
||||
const StructureFromAssemblies = PluginStateTransform.BuiltIn({
|
||||
name: 'Structure from all assemblies',
|
||||
display: { name: 'Structure from all assemblies' },
|
||||
from: PSO.Molecule.Model,
|
||||
to: PSO.Molecule.Structure,
|
||||
params: {
|
||||
}
|
||||
})({
|
||||
canAutoUpdate({ newParams }) {
|
||||
return true;
|
||||
},
|
||||
apply({ a, params }) {
|
||||
return Task.create('Build Structure', async ctx => {
|
||||
// TODO: optimze
|
||||
// TODO: think of ways how to fast-track changes to this for animations
|
||||
const model = a.data;
|
||||
let initial_structure = Structure.ofModel(model);
|
||||
const structures: Structure[] = [];
|
||||
let structure: Structure = initial_structure;
|
||||
// the list of asambly *?
|
||||
const symmetry = ModelSymmetry.Provider.get(model);
|
||||
if (symmetry && symmetry.assemblies.length !== 0){
|
||||
for (const a of symmetry.assemblies) {
|
||||
const s = await StructureSymmetry.buildAssembly(initial_structure, a.id).runInContext(ctx);
|
||||
structures.push(s);
|
||||
}
|
||||
const builder = Structure.Builder({ label: name });
|
||||
let offsetInvariantId = 0;
|
||||
for (const s of structures) {
|
||||
let maxInvariantId = 0;
|
||||
for (const u of s.units) {
|
||||
const invariantId = u.invariantId + offsetInvariantId;
|
||||
if (u.invariantId > maxInvariantId) maxInvariantId = u.invariantId;
|
||||
builder.addUnit(u.kind, u.model, u.conformation.operator, u.elements, Unit.Trait.None, invariantId);
|
||||
}
|
||||
offsetInvariantId += maxInvariantId + 1;
|
||||
}
|
||||
structure = builder.getStructure();
|
||||
for( let i = 0, il = structure.models.length; i < il; ++i) {
|
||||
const { trajectoryInfo } = structure.models[i];
|
||||
trajectoryInfo.size = il;
|
||||
trajectoryInfo.index = i;
|
||||
}
|
||||
}
|
||||
return new PSO.Molecule.Structure(structure, { label: a.label, description: `${a.description}` });
|
||||
});
|
||||
},
|
||||
dispose({ b }) {
|
||||
b?.data.customPropertyDescriptors.dispose();
|
||||
}
|
||||
});
|
||||
|
||||
// export { GetAllAssamblyinOneStructure };
|
||||
// type GetAllAssamblyinOneStructure = typeof GetAllAssamblyinOneStructure
|
||||
// const GetAllAssamblyinOneStructure = PluginStateTransform.BuiltIn({
|
||||
// name: 'get assambly from structure',
|
||||
// display: { name: 'get assambly from structure' },
|
||||
// isDecorator: true,
|
||||
// from: PSO.Molecule.Structure,
|
||||
// to: PSO.Molecule.Structure,
|
||||
// params(a) {
|
||||
// return { };
|
||||
// }
|
||||
// })({
|
||||
// apply({ a, params }) {
|
||||
// return Task.create('Build Structure Assemblies', async ctx => {
|
||||
// // TODO: optimze
|
||||
// // TODO: think of ways how to fast-track changes to this for animations
|
||||
// const initial_structure = a.data;
|
||||
// const structures: Structure[] = [];
|
||||
// let structure: Structure = initial_structure;
|
||||
// // the list of asambly *?
|
||||
// const symmetry = ModelSymmetry.Provider.get(initial_structure.model);
|
||||
// if (symmetry){
|
||||
// if (symmetry.assemblies.length !== 0) {
|
||||
// for (const a of symmetry.assemblies) {
|
||||
// const s = await StructureSymmetry.buildAssembly(initial_structure, a.id!).runInContext(ctx);
|
||||
// structures.push(s);
|
||||
// }
|
||||
// const builder = Structure.Builder({ label: name });
|
||||
// let offsetInvariantId = 0;
|
||||
// for (const s of structures) {
|
||||
// let maxInvariantId = 0;
|
||||
// for (const u of s.units) {
|
||||
// const invariantId = u.invariantId + offsetInvariantId;
|
||||
// if (u.invariantId > maxInvariantId) maxInvariantId = u.invariantId;
|
||||
// builder.addUnit(u.kind, u.model, u.conformation.operator, u.elements, Unit.Trait.None, invariantId);
|
||||
// }
|
||||
// offsetInvariantId += maxInvariantId + 1;
|
||||
// }
|
||||
// structure = builder.getStructure();
|
||||
// for( let i = 0, il = structure.models.length; i < il; ++i) {
|
||||
// const { trajectoryInfo } = structure.models[i];
|
||||
// trajectoryInfo.size = il;
|
||||
// trajectoryInfo.index = i;
|
||||
// }
|
||||
// }
|
||||
// }
|
||||
// return new PSO.Molecule.Structure(structure, { label: a.label, description: `${a.description}` });
|
||||
// });
|
||||
// }
|
||||
// });
|
||||
|
||||
|
||||
@@ -7,9 +7,10 @@
|
||||
import { Column, Table } from '../../mol-data/db';
|
||||
import { toTable } from '../../mol-io/reader/cif/schema';
|
||||
import { CifWriter } from '../../mol-io/writer/cif';
|
||||
import { Model, CustomPropertyDescriptor } from '../../mol-model/structure';
|
||||
import { Model } from '../../mol-model/structure';
|
||||
import { ModelSymmetry } from '../../mol-model-formats/structure/property/symmetry';
|
||||
import { MmcifFormat } from '../../mol-model-formats/structure/mmcif';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/custom-property';
|
||||
|
||||
export namespace PDBePreferredAssembly {
|
||||
export type Property = string
|
||||
|
||||
@@ -7,9 +7,10 @@
|
||||
import { Column, Table } from '../../mol-data/db';
|
||||
import { toTable } from '../../mol-io/reader/cif/schema';
|
||||
import { CifWriter } from '../../mol-io/writer/cif';
|
||||
import { Model, CustomPropertyDescriptor } from '../../mol-model/structure';
|
||||
import { Model } from '../../mol-model/structure';
|
||||
import { PropertyWrapper } from '../../mol-model-props/common/wrapper';
|
||||
import { MmcifFormat } from '../../mol-model-formats/structure/mmcif';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/custom-property';
|
||||
|
||||
export namespace PDBeStructRefDomain {
|
||||
export type Property = PropertyWrapper<Table<Schema['pdbe_struct_ref_domain']> | undefined>
|
||||
|
||||
@@ -9,7 +9,7 @@ import { Column, Table } from '../../../mol-data/db';
|
||||
import { toTable } from '../../../mol-io/reader/cif/schema';
|
||||
import { mmCIF_residueId_schema } from '../../../mol-io/reader/cif/schema/mmcif-extras';
|
||||
import { CifWriter } from '../../../mol-io/writer/cif';
|
||||
import { Model, CustomPropertyDescriptor, ResidueIndex, Unit, IndexedCustomProperty } from '../../../mol-model/structure';
|
||||
import { Model, ResidueIndex, Unit, IndexedCustomProperty } from '../../../mol-model/structure';
|
||||
import { residueIdFields } from '../../../mol-model/structure/export/categories/atom_site';
|
||||
import { StructureElement, CifExportContext, Structure } from '../../../mol-model/structure/structure';
|
||||
import { CustomPropSymbol } from '../../../mol-script/language/symbol';
|
||||
@@ -22,6 +22,7 @@ import { PropertyWrapper } from '../../../mol-model-props/common/wrapper';
|
||||
import { CustomProperty } from '../../../mol-model-props/common/custom-property';
|
||||
import { CustomModelProperty } from '../../../mol-model-props/common/custom-model-property';
|
||||
import { Asset } from '../../../mol-util/assets';
|
||||
import { CustomPropertyDescriptor } from '../../../mol-model/custom-property';
|
||||
|
||||
export { StructureQualityReport };
|
||||
|
||||
|
||||
@@ -8,7 +8,7 @@ import { AssemblySymmetryQuery, AssemblySymmetryQueryVariables } from '../graphq
|
||||
import query from '../graphql/symmetry.gql';
|
||||
|
||||
import { ParamDefinition as PD } from '../../../mol-util/param-definition';
|
||||
import { CustomPropertyDescriptor, Structure, Model, StructureSelection, QueryContext } from '../../../mol-model/structure';
|
||||
import { Structure, Model, StructureSelection, QueryContext } from '../../../mol-model/structure';
|
||||
import { Database as _Database, Column } from '../../../mol-data/db';
|
||||
import { GraphQLClient } from '../../../mol-util/graphql-client';
|
||||
import { CustomProperty } from '../../../mol-model-props/common/custom-property';
|
||||
@@ -19,6 +19,7 @@ import { ReadonlyVec3 } from '../../../mol-math/linear-algebra/3d/vec3';
|
||||
import { SetUtils } from '../../../mol-util/set';
|
||||
import { MolScriptBuilder as MS } from '../../../mol-script/language/builder';
|
||||
import { compile } from '../../../mol-script/runtime/query/compiler';
|
||||
import { CustomPropertyDescriptor } from '../../../mol-model/custom-property';
|
||||
|
||||
const BiologicalAssemblyNames = new Set([
|
||||
'author_and_software_defined_assembly',
|
||||
|
||||
@@ -186,12 +186,22 @@ const getSymbolCage = memoize1((symbol: string): Cage | undefined => {
|
||||
if (symbol.startsWith('D') || symbol.startsWith('C')) {
|
||||
// z axis is prism axis, x/y axes cut through edge midpoints
|
||||
const fold = parseInt(symbol.substr(1));
|
||||
let cage: Cage;
|
||||
if (fold === 2) {
|
||||
return PrismCage(polygon(4, false));
|
||||
cage = PrismCage(polygon(4, false));
|
||||
} else if (fold === 3) {
|
||||
return WedgeCage();
|
||||
cage = WedgeCage();
|
||||
} else if (fold > 3) {
|
||||
return PrismCage(polygon(fold, false));
|
||||
cage = PrismCage(polygon(fold, false));
|
||||
} else {
|
||||
return;
|
||||
}
|
||||
if (fold % 2 === 0) {
|
||||
return cage;
|
||||
} else {
|
||||
const m = Mat4.identity();
|
||||
Mat4.rotate(m, m, 1 / fold * Math.PI / 2, Vec3.unitZ);
|
||||
return transformCage(cloneCage(cage), m);
|
||||
}
|
||||
} else if (symbol === 'O') {
|
||||
// x/y/z axes cut through order 4 vertices
|
||||
@@ -237,7 +247,7 @@ function setSymbolTransform(t: Mat4, symbol: string, axes: AssemblySymmetry.Rota
|
||||
pair = axes.filter(a => a.order === 2);
|
||||
} else if (fold >= 3) {
|
||||
const aN = axes.filter(a => a.order === fold)[0];
|
||||
const a2 = axes.filter(a => a.order === 2)[0];
|
||||
const a2 = axes.filter(a => a.order === 2)[1];
|
||||
pair = [aN, a2];
|
||||
}
|
||||
} else if (symbol === 'O') {
|
||||
@@ -267,7 +277,19 @@ function setSymbolTransform(t: Mat4, symbol: string, axes: AssemblySymmetry.Rota
|
||||
Vec3.sub(dir, eye, target);
|
||||
if (Vec3.dot(dir, up) < 0) Vec3.negate(up, up);
|
||||
Mat4.targetTo(t, eye, target, up);
|
||||
Mat4.scaleUniformly(t, t, size * getSymbolScale(symbol));
|
||||
|
||||
if (symbol.startsWith('D')) {
|
||||
const { sphere } = structure.lookup3d.boundary;
|
||||
let sizeXY = (sphere.radius * 2) * 0.8; // fallback for missing extrema
|
||||
if (Sphere3D.hasExtrema(sphere)) {
|
||||
const n = Mat3.directionTransform(Mat3(), t);
|
||||
const dirs = unitCircleDirections.map(d => Vec3.transformMat3(Vec3(), d, n));
|
||||
sizeXY = getMaxProjectedDistance(sphere.extrema, dirs, sphere.center) * 1.6;
|
||||
}
|
||||
Mat4.scale(t, t, Vec3.create(sizeXY, sizeXY, Vec3.distance(aA.start, aA.end) * 0.9));
|
||||
} else {
|
||||
Mat4.scaleUniformly(t, t, size * getSymbolScale(symbol));
|
||||
}
|
||||
} else {
|
||||
if (Vec3.dot(Vec3.unitY, Vec3.sub(tmpV, aA.end, aA.start)) === 0) {
|
||||
Vec3.copy(up, Vec3.unitY);
|
||||
@@ -283,7 +305,6 @@ function setSymbolTransform(t: Mat4, symbol: string, axes: AssemblySymmetry.Rota
|
||||
const dirs = unitCircleDirections.map(d => Vec3.transformMat3(Vec3(), d, n));
|
||||
sizeXY = getMaxProjectedDistance(sphere.extrema, dirs, sphere.center);
|
||||
}
|
||||
|
||||
Mat4.scale(t, t, Vec3.create(sizeXY, sizeXY, size * 0.9));
|
||||
}
|
||||
}
|
||||
|
||||
@@ -222,12 +222,12 @@ function densityFitLabel(loci: Loci): string | undefined {
|
||||
if (rsrzSeen.size) {
|
||||
const rsrzCount = `<small>(${rsrzSeen.size} ${rsrzSeen.size > 1 ? 'Residues avg.' : 'Residue'})</small>`;
|
||||
const rsrzAvg = rsrzSum / rsrzSeen.size;
|
||||
summary.push(`Real Space R ${rsrzCount}: ${rsrzAvg.toFixed(2)}`);
|
||||
summary.push(`Real-Space R Z-score ${rsrzCount}: ${rsrzAvg.toFixed(2)}`);
|
||||
}
|
||||
if (rsccSeen.size) {
|
||||
const rsccCount = `<small>(${rsccSeen.size} ${rsccSeen.size > 1 ? 'Residues avg.' : 'Residue'})</small>`;
|
||||
const rsccAvg = rsccSum / rsccSeen.size;
|
||||
summary.push(`Real Space Correlation Coefficient ${rsccCount}: ${rsccAvg.toFixed(2)}`);
|
||||
summary.push(`Real-Space Correlation Coefficient ${rsccCount}: ${rsccAvg.toFixed(2)}`);
|
||||
}
|
||||
|
||||
if (summary.length) {
|
||||
|
||||
@@ -5,7 +5,7 @@
|
||||
*/
|
||||
|
||||
import { ParamDefinition as PD } from '../../../mol-util/param-definition';
|
||||
import { CustomPropertyDescriptor, Structure, Unit } from '../../../mol-model/structure';
|
||||
import { Structure, Unit } from '../../../mol-model/structure';
|
||||
import { CustomProperty } from '../../../mol-model-props/common/custom-property';
|
||||
import { CustomModelProperty } from '../../../mol-model-props/common/custom-model-property';
|
||||
import { Model, ElementIndex, ResidueIndex } from '../../../mol-model/structure/model';
|
||||
@@ -21,6 +21,7 @@ import { QuerySymbolRuntime } from '../../../mol-script/runtime/query/compiler';
|
||||
import { CustomPropSymbol } from '../../../mol-script/language/symbol';
|
||||
import Type from '../../../mol-script/language/type';
|
||||
import { Asset } from '../../../mol-util/assets';
|
||||
import { CustomPropertyDescriptor } from '../../../mol-model/custom-property';
|
||||
|
||||
export { ValidationReport };
|
||||
|
||||
|
||||
@@ -36,6 +36,7 @@ import { Sphere3D } from '../mol-math/geometry';
|
||||
import { isDebugMode } from '../mol-util/debug';
|
||||
import { CameraHelperParams } from './helper/camera-helper';
|
||||
import { produce } from 'immer';
|
||||
import { HandleHelper, HandleHelperParams } from './helper/handle-helper';
|
||||
|
||||
export const Canvas3DParams = {
|
||||
camera: PD.Group({
|
||||
@@ -60,7 +61,8 @@ export const Canvas3DParams = {
|
||||
postprocessing: PD.Group(PostprocessingParams),
|
||||
renderer: PD.Group(RendererParams),
|
||||
trackball: PD.Group(TrackballControlsParams),
|
||||
debug: PD.Group(DebugHelperParams)
|
||||
debug: PD.Group(DebugHelperParams),
|
||||
handle: PD.Group(HandleHelperParams),
|
||||
};
|
||||
export const DefaultCanvas3DParams = PD.getDefaultValues(Canvas3DParams);
|
||||
export type Canvas3DProps = PD.Values<typeof Canvas3DParams>
|
||||
@@ -188,12 +190,13 @@ namespace Canvas3D {
|
||||
const controls = TrackballControls.create(input, camera, p.trackball);
|
||||
const renderer = Renderer.create(webgl, p.renderer);
|
||||
const debugHelper = new BoundingSphereHelper(webgl, scene, p.debug);
|
||||
const handleHelper = new HandleHelper(webgl, p.handle);
|
||||
const interactionHelper = new Canvas3dInteractionHelper(identify, getLoci, input);
|
||||
|
||||
const drawPass = new DrawPass(webgl, renderer, scene, camera, debugHelper, {
|
||||
const drawPass = new DrawPass(webgl, renderer, scene, camera, debugHelper, handleHelper, {
|
||||
cameraHelper: p.camera.helper
|
||||
});
|
||||
const pickPass = new PickPass(webgl, renderer, scene, camera, 0.5);
|
||||
const pickPass = new PickPass(webgl, renderer, scene, camera, handleHelper, 0.5);
|
||||
const postprocessing = new PostprocessingPass(webgl, camera, drawPass, p.postprocessing);
|
||||
const multiSample = new MultiSamplePass(webgl, camera, drawPass, postprocessing, p.multiSample);
|
||||
|
||||
@@ -205,6 +208,7 @@ namespace Canvas3D {
|
||||
function getLoci(pickingId: PickingId) {
|
||||
let loci: Loci = EmptyLoci;
|
||||
let repr: Representation.Any = Representation.Empty;
|
||||
loci = handleHelper.getLoci(pickingId);
|
||||
reprRenderObjects.forEach((_, _repr) => {
|
||||
const _loci = _repr.getLoci(pickingId);
|
||||
if (!isEmptyLoci(_loci)) {
|
||||
@@ -224,10 +228,12 @@ namespace Canvas3D {
|
||||
if (repr) {
|
||||
changed = repr.mark(loci, action);
|
||||
} else {
|
||||
changed = handleHelper.mark(loci, action);
|
||||
reprRenderObjects.forEach((_, _repr) => { changed = _repr.mark(loci, action) || changed; });
|
||||
}
|
||||
if (changed) {
|
||||
scene.update(void 0, true);
|
||||
handleHelper.scene.update(void 0, true);
|
||||
const prevPickDirty = pickPass.pickDirty;
|
||||
draw(true);
|
||||
pickPass.pickDirty = prevPickDirty; // marking does not change picking buffers
|
||||
@@ -356,10 +362,19 @@ namespace Canvas3D {
|
||||
|
||||
camera.setState({ radiusMax: scene.boundingSphere.radius }, 0);
|
||||
reprCount.next(reprRenderObjects.size);
|
||||
if (isDebugMode) consoleStats();
|
||||
|
||||
return true;
|
||||
}
|
||||
|
||||
function consoleStats() {
|
||||
console.table(scene.renderables.map(r => ({
|
||||
drawCount: r.values.drawCount.ref.value,
|
||||
instanceCount: r.values.instanceCount.ref.value,
|
||||
materialId: r.materialId,
|
||||
})));
|
||||
}
|
||||
|
||||
function add(repr: Representation.Any) {
|
||||
registerAutoUpdate(repr);
|
||||
|
||||
@@ -378,6 +393,7 @@ namespace Canvas3D {
|
||||
reprRenderObjects.set(repr, newRO);
|
||||
|
||||
scene.update(repr.renderObjects, false);
|
||||
if (isDebugMode) consoleStats();
|
||||
}
|
||||
|
||||
function remove(repr: Representation.Any) {
|
||||
@@ -388,6 +404,7 @@ namespace Canvas3D {
|
||||
renderObjects.forEach(o => scene.remove(o));
|
||||
reprRenderObjects.delete(repr);
|
||||
scene.update(repr.renderObjects, false, true);
|
||||
if (isDebugMode) consoleStats();
|
||||
}
|
||||
}
|
||||
|
||||
@@ -428,7 +445,8 @@ namespace Canvas3D {
|
||||
multiSample: { ...multiSample.props },
|
||||
renderer: { ...renderer.props },
|
||||
trackball: { ...controls.props },
|
||||
debug: { ...debugHelper.props }
|
||||
debug: { ...debugHelper.props },
|
||||
handle: { ...handleHelper.props },
|
||||
};
|
||||
}
|
||||
|
||||
@@ -535,11 +553,12 @@ namespace Canvas3D {
|
||||
if (props.renderer) renderer.setProps(props.renderer);
|
||||
if (props.trackball) controls.setProps(props.trackball);
|
||||
if (props.debug) debugHelper.setProps(props.debug);
|
||||
if (props.handle) handleHelper.setProps(props.handle);
|
||||
|
||||
requestDraw(true);
|
||||
},
|
||||
getImagePass: (props: Partial<ImageProps> = {}) => {
|
||||
return new ImagePass(webgl, renderer, scene, camera, debugHelper, props);
|
||||
return new ImagePass(webgl, renderer, scene, camera, debugHelper, handleHelper, props);
|
||||
},
|
||||
|
||||
get props() {
|
||||
@@ -563,7 +582,8 @@ namespace Canvas3D {
|
||||
multiSample: { ...multiSample.props },
|
||||
renderer: { ...renderer.props },
|
||||
trackball: { ...controls.props },
|
||||
debug: { ...debugHelper.props }
|
||||
debug: { ...debugHelper.props },
|
||||
handle: { ...handleHelper.props },
|
||||
};
|
||||
},
|
||||
get input() {
|
||||
|
||||
208
src/mol-canvas3d/helper/handle-helper.ts
Normal file
208
src/mol-canvas3d/helper/handle-helper.ts
Normal file
@@ -0,0 +1,208 @@
|
||||
/**
|
||||
* Copyright (c) 2020 mol* contributors, licensed under MIT, See LICENSE file for more info.
|
||||
*
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { WebGLContext } from '../../mol-gl/webgl/context';
|
||||
import Scene from '../../mol-gl/scene';
|
||||
import { MeshBuilder } from '../../mol-geo/geometry/mesh/mesh-builder';
|
||||
import { Vec3, Mat4, Mat3 } from '../../mol-math/linear-algebra';
|
||||
import { addSphere } from '../../mol-geo/geometry/mesh/builder/sphere';
|
||||
import { GraphicsRenderObject } from '../../mol-gl/render-object';
|
||||
import { Mesh } from '../../mol-geo/geometry/mesh/mesh';
|
||||
import { ColorNames } from '../../mol-util/color/names';
|
||||
import { addCylinder } from '../../mol-geo/geometry/mesh/builder/cylinder';
|
||||
import { ValueCell } from '../../mol-util';
|
||||
import { Sphere3D } from '../../mol-math/geometry';
|
||||
import { ParamDefinition as PD } from '../../mol-util/param-definition';
|
||||
import produce from 'immer';
|
||||
import { Shape } from '../../mol-model/shape';
|
||||
import { PickingId } from '../../mol-geo/geometry/picking';
|
||||
import { Camera } from '../camera';
|
||||
import { DataLoci, EmptyLoci, Loci } from '../../mol-model/loci';
|
||||
import { MarkerAction, MarkerActions } from '../../mol-util/marker-action';
|
||||
import { Visual } from '../../mol-repr/visual';
|
||||
import { Interval } from '../../mol-data/int';
|
||||
|
||||
const HandleParams = {
|
||||
...Mesh.Params,
|
||||
alpha: { ...Mesh.Params.alpha, defaultValue: 1 },
|
||||
ignoreLight: { ...Mesh.Params.ignoreLight, defaultValue: true },
|
||||
colorX: PD.Color(ColorNames.red, { isEssential: true }),
|
||||
colorY: PD.Color(ColorNames.green, { isEssential: true }),
|
||||
colorZ: PD.Color(ColorNames.blue, { isEssential: true }),
|
||||
scale: PD.Numeric(0.33, { min: 0.1, max: 2, step: 0.1 }, { isEssential: true }),
|
||||
};
|
||||
type HandleParams = typeof HandleParams
|
||||
type HandleProps = PD.Values<HandleParams>
|
||||
|
||||
export const HandleHelperParams = {
|
||||
handle: PD.MappedStatic('off', {
|
||||
on: PD.Group(HandleParams),
|
||||
off: PD.Group({})
|
||||
}, { cycle: true, description: 'Show handle tool' }),
|
||||
};
|
||||
export type HandleHelperParams = typeof HandleHelperParams
|
||||
export type HandleHelperProps = PD.Values<HandleHelperParams>
|
||||
|
||||
export class HandleHelper {
|
||||
scene: Scene
|
||||
props: HandleHelperProps = {
|
||||
handle: { name: 'off', params: {} }
|
||||
}
|
||||
|
||||
private renderObject: GraphicsRenderObject | undefined
|
||||
|
||||
private _transform = Mat4();
|
||||
getBoundingSphere(out: Sphere3D, instanceId: number) {
|
||||
if (this.renderObject) {
|
||||
Sphere3D.copy(out, this.renderObject.values.invariantBoundingSphere.ref.value);
|
||||
Mat4.fromArray(this._transform, this.renderObject.values.aTransform.ref.value, instanceId * 16);
|
||||
Sphere3D.transform(out, out, this._transform);
|
||||
}
|
||||
return out;
|
||||
}
|
||||
|
||||
setProps(props: Partial<HandleHelperProps>) {
|
||||
this.props = produce(this.props, p => {
|
||||
if (props.handle !== undefined) {
|
||||
p.handle.name = props.handle.name;
|
||||
if (props.handle.name === 'on') {
|
||||
this.scene.clear();
|
||||
const params = { ...props.handle.params, scale: props.handle.params.scale * this.webgl.pixelRatio };
|
||||
this.renderObject = createHandleRenderObject(params);
|
||||
this.scene.add(this.renderObject);
|
||||
this.scene.commit();
|
||||
|
||||
p.handle.params = { ...props.handle.params };
|
||||
}
|
||||
}
|
||||
});
|
||||
}
|
||||
|
||||
get isEnabled() {
|
||||
return this.props.handle.name === 'on';
|
||||
}
|
||||
|
||||
// TODO could be a lists of position/rotation if we want to show more than one handle tool,
|
||||
// they would be distingishable by their instanceId
|
||||
update(camera: Camera, position: Vec3, rotation: Mat3) {
|
||||
if (!this.renderObject) return;
|
||||
|
||||
Mat4.setTranslation(this.renderObject.values.aTransform.ref.value as unknown as Mat4, position);
|
||||
Mat4.fromMat3(this.renderObject.values.aTransform.ref.value as unknown as Mat4, rotation);
|
||||
|
||||
// TODO make invariant to camera scaling by adjusting renderObject transform
|
||||
|
||||
ValueCell.update(this.renderObject.values.aTransform, this.renderObject.values.aTransform.ref.value);
|
||||
this.scene.update([this.renderObject], true);
|
||||
}
|
||||
|
||||
getLoci(pickingId: PickingId) {
|
||||
const { objectId, groupId, instanceId } = pickingId;
|
||||
if (!this.renderObject || objectId !== this.renderObject.id) return EmptyLoci;
|
||||
return HandleLoci(this, groupId, instanceId);
|
||||
}
|
||||
|
||||
private eachGroup = (loci: Loci, apply: (interval: Interval) => boolean): boolean => {
|
||||
if (!this.renderObject) return false;
|
||||
if (!isHandleLoci(loci)) return false;
|
||||
let changed = false;
|
||||
const groupCount = this.renderObject.values.uGroupCount.ref.value;
|
||||
const { elements } = loci;
|
||||
for (const { groupId, instanceId } of elements) {
|
||||
const idx = instanceId * groupCount + groupId;
|
||||
if (apply(Interval.ofSingleton(idx))) changed = true;
|
||||
}
|
||||
return changed;
|
||||
}
|
||||
|
||||
mark(loci: Loci, action: MarkerAction) {
|
||||
if (!MarkerActions.is(MarkerActions.Highlighting, action)) return false;
|
||||
if (!isHandleLoci(loci)) return false;
|
||||
if (loci.data !== this) return false;
|
||||
return Visual.mark(this.renderObject, loci, action, this.eachGroup);
|
||||
}
|
||||
|
||||
constructor(private webgl: WebGLContext, props: Partial<HandleHelperProps> = {}) {
|
||||
this.scene = Scene.create(webgl);
|
||||
this.setProps(props);
|
||||
}
|
||||
}
|
||||
|
||||
function createHandleMesh(scale: number, mesh?: Mesh) {
|
||||
const state = MeshBuilder.createState(512, 256, mesh);
|
||||
const radius = 0.05 * scale;
|
||||
const x = Vec3.scale(Vec3(), Vec3.unitX, scale);
|
||||
const y = Vec3.scale(Vec3(), Vec3.unitY, scale);
|
||||
const z = Vec3.scale(Vec3(), Vec3.unitZ, scale);
|
||||
const cylinderProps = { radiusTop: radius, radiusBottom: radius, radialSegments: 32 };
|
||||
|
||||
state.currentGroup = HandleGroup.TranslateScreenXY;
|
||||
addSphere(state, Vec3.origin, radius * 3, 2);
|
||||
|
||||
state.currentGroup = HandleGroup.TranslateObjectX;
|
||||
addSphere(state, x, radius, 2);
|
||||
addCylinder(state, Vec3.origin, x, 1, cylinderProps);
|
||||
|
||||
state.currentGroup = HandleGroup.TranslateObjectY;
|
||||
addSphere(state, y, radius, 2);
|
||||
addCylinder(state, Vec3.origin, y, 1, cylinderProps);
|
||||
|
||||
state.currentGroup = HandleGroup.TranslateObjectZ;
|
||||
addSphere(state, z, radius, 2);
|
||||
addCylinder(state, Vec3.origin, z, 1, cylinderProps);
|
||||
|
||||
// TODO add more helper geometries for the other HandleGroup options
|
||||
// TODO add props to create subset of geometries
|
||||
|
||||
return MeshBuilder.getMesh(state);
|
||||
}
|
||||
|
||||
export const HandleGroup = {
|
||||
None: 0,
|
||||
TranslateScreenXY: 1,
|
||||
// TranslateScreenZ: 2,
|
||||
TranslateObjectX: 3,
|
||||
TranslateObjectY: 4,
|
||||
TranslateObjectZ: 5,
|
||||
// TranslateObjectXY: 6,
|
||||
// TranslateObjectXZ: 7,
|
||||
// TranslateObjectYZ: 8,
|
||||
|
||||
// RotateScreenZ: 9,
|
||||
// RotateObjectX: 10,
|
||||
// RotateObjectY: 11,
|
||||
// RotateObjectZ: 12,
|
||||
} as const;
|
||||
|
||||
function HandleLoci(handleHelper: HandleHelper, groupId: number, instanceId: number) {
|
||||
return DataLoci('handle', handleHelper, [{ groupId, instanceId }],
|
||||
(boundingSphere: Sphere3D) => handleHelper.getBoundingSphere(boundingSphere, instanceId),
|
||||
() => `Handle Helper | Group Id ${groupId} | Instance Id ${instanceId}`);
|
||||
}
|
||||
export type HandleLoci = ReturnType<typeof HandleLoci>
|
||||
export function isHandleLoci(x: Loci): x is HandleLoci {
|
||||
return x.kind === 'data-loci' && x.tag === 'handle';
|
||||
}
|
||||
|
||||
function getHandleShape(props: HandleProps, shape?: Shape<Mesh>) {
|
||||
const scale = 10 * props.scale;
|
||||
const mesh = createHandleMesh(scale, shape?.geometry);
|
||||
mesh.setBoundingSphere(Sphere3D.create(Vec3.create(scale / 2, scale / 2, scale / 2), scale + scale / 4));
|
||||
const getColor = (groupId: number) => {
|
||||
switch (groupId) {
|
||||
case HandleGroup.TranslateObjectX: return props.colorX;
|
||||
case HandleGroup.TranslateObjectY: return props.colorY;
|
||||
case HandleGroup.TranslateObjectZ: return props.colorZ;
|
||||
default: return ColorNames.grey;
|
||||
}
|
||||
};
|
||||
return Shape.create('handle', {}, mesh, getColor, () => 1, () => '');
|
||||
}
|
||||
|
||||
function createHandleRenderObject(props: HandleProps) {
|
||||
const shape = getHandleShape(props);
|
||||
return Shape.createRenderObject(shape, props);
|
||||
}
|
||||
@@ -13,6 +13,7 @@ import { Texture } from '../../mol-gl/webgl/texture';
|
||||
import { Camera } from '../camera';
|
||||
import { CameraHelper, CameraHelperParams } from '../helper/camera-helper';
|
||||
import { ParamDefinition as PD } from '../../mol-util/param-definition';
|
||||
import { HandleHelper } from '../helper/handle-helper';
|
||||
|
||||
export const DrawPassParams = {
|
||||
cameraHelper: PD.Group(CameraHelperParams)
|
||||
@@ -29,7 +30,7 @@ export class DrawPass {
|
||||
|
||||
private depthTarget: RenderTarget | null
|
||||
|
||||
constructor(private webgl: WebGLContext, private renderer: Renderer, private scene: Scene, private camera: Camera, private debugHelper: BoundingSphereHelper, props: Partial<DrawPassProps> = {}) {
|
||||
constructor(private webgl: WebGLContext, private renderer: Renderer, private scene: Scene, private camera: Camera, private debugHelper: BoundingSphereHelper, private handleHelper: HandleHelper, props: Partial<DrawPassProps> = {}) {
|
||||
const { gl, extensions, resources } = webgl;
|
||||
const width = gl.drawingBufferWidth;
|
||||
const height = gl.drawingBufferHeight;
|
||||
@@ -89,12 +90,15 @@ export class DrawPass {
|
||||
}
|
||||
|
||||
private renderInternal(variant: 'color' | 'depth', transparentBackground: boolean) {
|
||||
const { renderer, scene, camera, debugHelper, cameraHelper } = this;
|
||||
const { renderer, scene, camera, debugHelper, cameraHelper, handleHelper } = this;
|
||||
renderer.render(scene, camera, variant, true, transparentBackground);
|
||||
if (debugHelper.isEnabled) {
|
||||
debugHelper.syncVisibility();
|
||||
renderer.render(debugHelper.scene, camera, variant, false, transparentBackground);
|
||||
}
|
||||
if (handleHelper.isEnabled) {
|
||||
renderer.render(handleHelper.scene, camera, variant, false, transparentBackground);
|
||||
}
|
||||
if (cameraHelper.isEnabled) {
|
||||
cameraHelper.update(camera);
|
||||
renderer.render(cameraHelper.scene, cameraHelper.camera, variant, false, transparentBackground);
|
||||
|
||||
@@ -15,6 +15,7 @@ import { PostprocessingPass, PostprocessingParams } from './postprocessing';
|
||||
import { MultiSamplePass, MultiSampleParams } from './multi-sample';
|
||||
import { Camera } from '../camera';
|
||||
import { Viewport } from '../camera/util';
|
||||
import { HandleHelper } from '../helper/handle-helper';
|
||||
|
||||
export const ImageParams = {
|
||||
transparentBackground: PD.Boolean(false),
|
||||
@@ -40,12 +41,12 @@ export class ImagePass {
|
||||
get width() { return this._width; }
|
||||
get height() { return this._height; }
|
||||
|
||||
constructor(webgl: WebGLContext, private renderer: Renderer, scene: Scene, private camera: Camera, debugHelper: BoundingSphereHelper, props: Partial<ImageProps>) {
|
||||
constructor(webgl: WebGLContext, private renderer: Renderer, scene: Scene, private camera: Camera, debugHelper: BoundingSphereHelper, handleHelper: HandleHelper, props: Partial<ImageProps>) {
|
||||
const p = { ...PD.getDefaultValues(ImageParams), ...props };
|
||||
|
||||
this._transparentBackground = p.transparentBackground;
|
||||
|
||||
this.drawPass = new DrawPass(webgl, renderer, scene, this._camera, debugHelper, p.drawPass);
|
||||
this.drawPass = new DrawPass(webgl, renderer, scene, this._camera, debugHelper, handleHelper, p.drawPass);
|
||||
this.postprocessing = new PostprocessingPass(webgl, this._camera, this.drawPass, p.postprocessing);
|
||||
this.multiSample = new MultiSamplePass(webgl, this._camera, this.drawPass, this.postprocessing, p.multiSample);
|
||||
|
||||
|
||||
@@ -11,6 +11,7 @@ import Scene from '../../mol-gl/scene';
|
||||
import { PickingId } from '../../mol-geo/geometry/picking';
|
||||
import { decodeFloatRGB } from '../../mol-util/float-packing';
|
||||
import { Camera } from '../camera';
|
||||
import { HandleHelper } from '../helper/handle-helper';
|
||||
|
||||
export class PickPass {
|
||||
pickDirty = true
|
||||
@@ -27,7 +28,7 @@ export class PickPass {
|
||||
private pickWidth: number
|
||||
private pickHeight: number
|
||||
|
||||
constructor(private webgl: WebGLContext, private renderer: Renderer, private scene: Scene, private camera: Camera, private pickBaseScale: number) {
|
||||
constructor(private webgl: WebGLContext, private renderer: Renderer, private scene: Scene, private camera: Camera, private handleHelper: HandleHelper, private pickBaseScale: number) {
|
||||
const { gl } = webgl;
|
||||
const width = gl.drawingBufferWidth;
|
||||
const height = gl.drawingBufferHeight;
|
||||
@@ -65,14 +66,18 @@ export class PickPass {
|
||||
}
|
||||
|
||||
render() {
|
||||
const { renderer, scene, camera } = this;
|
||||
const { renderer, scene, camera, handleHelper: { scene: handleScene } } = this;
|
||||
renderer.setViewport(0, 0, this.pickWidth, this.pickHeight);
|
||||
|
||||
this.objectPickTarget.bind();
|
||||
renderer.render(scene, camera, 'pickObject', true, false);
|
||||
renderer.render(handleScene, camera, 'pickObject', false, false);
|
||||
this.instancePickTarget.bind();
|
||||
renderer.render(scene, camera, 'pickInstance', true, false);
|
||||
renderer.render(handleScene, camera, 'pickInstance', false, false);
|
||||
this.groupPickTarget.bind();
|
||||
renderer.render(scene, camera, 'pickGroup', true, false);
|
||||
renderer.render(handleScene, camera, 'pickGroup', false, false);
|
||||
|
||||
this.pickDirty = false;
|
||||
}
|
||||
|
||||
@@ -59,7 +59,7 @@ export const PostprocessingParams = {
|
||||
outline: PD.MappedStatic('off', {
|
||||
on: PD.Group({
|
||||
scale: PD.Numeric(1, { min: 0, max: 10, step: 1 }),
|
||||
threshold: PD.Numeric(0.8, { min: 0, max: 1, step: 0.01 }),
|
||||
threshold: PD.Numeric(0.8, { min: 0, max: 5, step: 0.01 }),
|
||||
}),
|
||||
off: PD.Group({})
|
||||
}, { cycle: true, description: 'Draw outline around 3D objects' })
|
||||
|
||||
@@ -207,5 +207,6 @@ export namespace Points {
|
||||
!props.pointFilledCircle ||
|
||||
(props.pointFilledCircle && props.pointEdgeBleach === 0)
|
||||
);
|
||||
state.writeDepth = state.opaque;
|
||||
}
|
||||
}
|
||||
@@ -283,6 +283,7 @@ export namespace Text {
|
||||
BaseGeometry.updateRenderableState(state, props);
|
||||
state.pickable = false;
|
||||
state.opaque = false;
|
||||
state.writeDepth = true;
|
||||
}
|
||||
}
|
||||
|
||||
|
||||
@@ -44,9 +44,6 @@ export function createRenderable<T extends Values<RenderableSchema>>(renderItem:
|
||||
if (values.uAlpha && values.alpha) {
|
||||
ValueCell.updateIfChanged(values.uAlpha, clamp(values.alpha.ref.value * state.alphaFactor, 0, 1));
|
||||
}
|
||||
if (values.uPickable) {
|
||||
ValueCell.updateIfChanged(values.uPickable, state.pickable ? 1 : 0);
|
||||
}
|
||||
renderItem.render(variant);
|
||||
},
|
||||
getProgram: (variant: GraphicsRenderVariant) => renderItem.getProgram(variant),
|
||||
|
||||
@@ -73,7 +73,6 @@ export function DirectVolumeRenderable(ctx: WebGLContext, id: number, values: Di
|
||||
const schema = { ...GlobalUniformSchema, ...InternalSchema, ...DirectVolumeSchema };
|
||||
const internalValues: InternalValues = {
|
||||
uObjectId: ValueCell.create(id),
|
||||
uPickable: ValueCell.create(state.pickable ? 1 : 0),
|
||||
};
|
||||
const shaderCode = DirectVolumeShaderCode;
|
||||
const renderItem = createGraphicsRenderItem(ctx, 'triangles', shaderCode, schema, { ...values, ...internalValues }, materialId);
|
||||
|
||||
@@ -33,7 +33,6 @@ export function ImageRenderable(ctx: WebGLContext, id: number, values: ImageValu
|
||||
const schema = { ...GlobalUniformSchema, ...InternalSchema, ...ImageSchema };
|
||||
const internalValues: InternalValues = {
|
||||
uObjectId: ValueCell.create(id),
|
||||
uPickable: ValueCell.create(state.pickable ? 1 : 0),
|
||||
};
|
||||
const shaderCode = ImageShaderCode;
|
||||
const renderItem = createGraphicsRenderItem(ctx, 'triangles', shaderCode, schema, { ...values, ...internalValues }, materialId);
|
||||
|
||||
@@ -29,7 +29,6 @@ export function LinesRenderable(ctx: WebGLContext, id: number, values: LinesValu
|
||||
const schema = { ...GlobalUniformSchema, ...InternalSchema, ...LinesSchema };
|
||||
const internalValues: InternalValues = {
|
||||
uObjectId: ValueCell.create(id),
|
||||
uPickable: ValueCell.create(state.pickable ? 1 : 0)
|
||||
};
|
||||
const shaderCode = LinesShaderCode;
|
||||
const renderItem = createGraphicsRenderItem(ctx, 'triangles', shaderCode, schema, { ...values, ...internalValues }, materialId);
|
||||
|
||||
@@ -28,7 +28,6 @@ export function MeshRenderable(ctx: WebGLContext, id: number, values: MeshValues
|
||||
const schema = { ...GlobalUniformSchema, ...InternalSchema, ...MeshSchema };
|
||||
const internalValues: InternalValues = {
|
||||
uObjectId: ValueCell.create(id),
|
||||
uPickable: ValueCell.create(state.pickable ? 1 : 0)
|
||||
};
|
||||
const shaderCode = MeshShaderCode;
|
||||
const renderItem = createGraphicsRenderItem(ctx, 'triangles', shaderCode, schema, { ...values, ...internalValues }, materialId);
|
||||
|
||||
@@ -26,7 +26,6 @@ export function PointsRenderable(ctx: WebGLContext, id: number, values: PointsVa
|
||||
const schema = { ...GlobalUniformSchema, ...InternalSchema, ...PointsSchema };
|
||||
const internalValues: InternalValues = {
|
||||
uObjectId: ValueCell.create(id),
|
||||
uPickable: ValueCell.create(state.pickable ? 1 : 0)
|
||||
};
|
||||
const shaderCode = PointsShaderCode;
|
||||
const renderItem = createGraphicsRenderItem(ctx, 'points', shaderCode, schema, { ...values, ...internalValues }, materialId);
|
||||
|
||||
@@ -187,7 +187,6 @@ export type GlobalUniformValues = Values<GlobalUniformSchema> // { [k in keyof G
|
||||
|
||||
export const InternalSchema = {
|
||||
uObjectId: UniformSpec('i'),
|
||||
uPickable: UniformSpec('i', true),
|
||||
} as const;
|
||||
export type InternalSchema = typeof InternalSchema
|
||||
export type InternalValues = { [k in keyof InternalSchema]: ValueCell<any> }
|
||||
|
||||
@@ -29,7 +29,6 @@ export function SpheresRenderable(ctx: WebGLContext, id: number, values: Spheres
|
||||
const schema = { ...GlobalUniformSchema, ...InternalSchema, ...SpheresSchema };
|
||||
const internalValues: InternalValues = {
|
||||
uObjectId: ValueCell.create(id),
|
||||
uPickable: ValueCell.create(state.pickable ? 1 : 0)
|
||||
};
|
||||
const shaderCode = SpheresShaderCode;
|
||||
const renderItem = createGraphicsRenderItem(ctx, 'triangles', shaderCode, schema, { ...values, ...internalValues }, materialId);
|
||||
|
||||
@@ -38,7 +38,6 @@ export function TextRenderable(ctx: WebGLContext, id: number, values: TextValues
|
||||
const schema = { ...GlobalUniformSchema, ...InternalSchema, ...TextSchema };
|
||||
const internalValues: InternalValues = {
|
||||
uObjectId: ValueCell.create(id),
|
||||
uPickable: ValueCell.create(state.pickable ? 1 : 0)
|
||||
};
|
||||
const shaderCode = TextShaderCode;
|
||||
const renderItem = createGraphicsRenderItem(ctx, 'triangles', shaderCode, schema, { ...values, ...internalValues }, materialId);
|
||||
|
||||
@@ -31,7 +31,6 @@ export function TextureMeshRenderable(ctx: WebGLContext, id: number, values: Tex
|
||||
const schema = { ...GlobalUniformSchema, ...InternalSchema, ...TextureMeshSchema };
|
||||
const internalValues: InternalValues = {
|
||||
uObjectId: ValueCell.create(id),
|
||||
uPickable: ValueCell.create(state.pickable ? 1 : 0)
|
||||
};
|
||||
const shaderCode = MeshShaderCode;
|
||||
const renderItem = createGraphicsRenderItem(ctx, 'triangles', shaderCode, schema, { ...values, ...internalValues }, materialId);
|
||||
|
||||
@@ -173,51 +173,53 @@ namespace Renderer {
|
||||
let globalUniformsNeedUpdate = true;
|
||||
|
||||
const renderObject = (r: Renderable<RenderableValues & BaseValues>, variant: GraphicsRenderVariant) => {
|
||||
if (!r.state.visible || (!r.state.pickable && variant[0] === 'p')) {
|
||||
return;
|
||||
}
|
||||
|
||||
const program = r.getProgram(variant);
|
||||
if (r.state.visible) {
|
||||
if (state.currentProgramId !== program.id) {
|
||||
// console.log('new program')
|
||||
globalUniformsNeedUpdate = true;
|
||||
program.use();
|
||||
}
|
||||
if (state.currentProgramId !== program.id) {
|
||||
// console.log('new program')
|
||||
globalUniformsNeedUpdate = true;
|
||||
program.use();
|
||||
}
|
||||
|
||||
if (globalUniformsNeedUpdate) {
|
||||
// console.log('globalUniformsNeedUpdate')
|
||||
program.setUniforms(globalUniformList);
|
||||
globalUniformsNeedUpdate = false;
|
||||
}
|
||||
if (globalUniformsNeedUpdate) {
|
||||
// console.log('globalUniformsNeedUpdate')
|
||||
program.setUniforms(globalUniformList);
|
||||
globalUniformsNeedUpdate = false;
|
||||
}
|
||||
|
||||
if (r.values.dDoubleSided) {
|
||||
if (r.values.dDoubleSided.ref.value) {
|
||||
state.disable(gl.CULL_FACE);
|
||||
} else {
|
||||
state.enable(gl.CULL_FACE);
|
||||
}
|
||||
} else {
|
||||
// webgl default
|
||||
if (r.values.dDoubleSided) {
|
||||
if (r.values.dDoubleSided.ref.value) {
|
||||
state.disable(gl.CULL_FACE);
|
||||
}
|
||||
|
||||
if (r.values.dFlipSided) {
|
||||
if (r.values.dFlipSided.ref.value) {
|
||||
state.frontFace(gl.CW);
|
||||
state.cullFace(gl.FRONT);
|
||||
} else {
|
||||
state.frontFace(gl.CCW);
|
||||
state.cullFace(gl.BACK);
|
||||
}
|
||||
} else {
|
||||
// webgl default
|
||||
state.enable(gl.CULL_FACE);
|
||||
}
|
||||
} else {
|
||||
// webgl default
|
||||
state.disable(gl.CULL_FACE);
|
||||
}
|
||||
|
||||
if (r.values.dFlipSided) {
|
||||
if (r.values.dFlipSided.ref.value) {
|
||||
state.frontFace(gl.CW);
|
||||
state.cullFace(gl.FRONT);
|
||||
} else {
|
||||
state.frontFace(gl.CCW);
|
||||
state.cullFace(gl.BACK);
|
||||
}
|
||||
|
||||
if (variant === 'color') {
|
||||
state.depthMask(r.state.writeDepth);
|
||||
}
|
||||
|
||||
r.render(variant);
|
||||
} else {
|
||||
// webgl default
|
||||
state.frontFace(gl.CCW);
|
||||
state.cullFace(gl.BACK);
|
||||
}
|
||||
|
||||
if (variant === 'color') {
|
||||
state.depthMask(r.state.writeDepth);
|
||||
}
|
||||
|
||||
r.render(variant);
|
||||
};
|
||||
|
||||
const render = (scene: Scene, camera: Camera, variant: GraphicsRenderVariant, clear: boolean, transparentBackground: boolean) => {
|
||||
|
||||
@@ -1,8 +1,11 @@
|
||||
export default `
|
||||
float depth = length(vViewPosition);
|
||||
float fogFactor = smoothstep(uFogNear, uFogFar, depth);
|
||||
float fogAlpha = (1.0 - fogFactor) * gl_FragColor.a;
|
||||
if (uTransparentBackground == 0) {
|
||||
gl_FragColor.rgb = mix(gl_FragColor.rgb, uFogColor, fogFactor);
|
||||
if (gl_FragColor.a < 1.0)
|
||||
gl_FragColor.a = fogAlpha;
|
||||
} else {
|
||||
float fogAlpha = (1.0 - fogFactor) * gl_FragColor.a;
|
||||
gl_FragColor.a = fogAlpha;
|
||||
|
||||
@@ -1,13 +1,10 @@
|
||||
export default `
|
||||
// only mark elements with an alpha above the picking threshold
|
||||
if (gl_FragColor.a >= uPickingAlphaThreshold) {
|
||||
float marker = floor(vMarker * 255.0 + 0.5); // rounding required to work on some cards on win
|
||||
if (marker > 0.1) {
|
||||
if (intMod(marker, 2.0) > 0.1) {
|
||||
gl_FragColor.rgb = mix(uHighlightColor, gl_FragColor.rgb, 0.3);
|
||||
} else {
|
||||
gl_FragColor.rgb = mix(uSelectColor, gl_FragColor.rgb, 0.3);
|
||||
}
|
||||
float marker = floor(vMarker * 255.0 + 0.5); // rounding required to work on some cards on win
|
||||
if (marker > 0.1) {
|
||||
if (intMod(marker, 2.0) > 0.1) {
|
||||
gl_FragColor.rgb = mix(uHighlightColor, gl_FragColor.rgb, 0.3);
|
||||
} else {
|
||||
gl_FragColor.rgb = mix(uSelectColor, gl_FragColor.rgb, 0.3);
|
||||
}
|
||||
}
|
||||
`;
|
||||
@@ -34,7 +34,7 @@ export default `
|
||||
if (ta < 0.99 && (ta < 0.01 || ta < at)) discard;
|
||||
#endif
|
||||
#elif defined(dRenderVariant_pick)
|
||||
vec4 material = uPickable == 1 ? vColor : vec4(0.0, 0.0, 0.0, 1.0); // set to empty picking id
|
||||
vec4 material = vColor;
|
||||
#elif defined(dRenderVariant_depth)
|
||||
#ifdef enabledFragDepth
|
||||
vec4 material = packDepthToRGBA(gl_FragDepthEXT);
|
||||
|
||||
@@ -21,7 +21,6 @@ uniform vec3 uFogColor;
|
||||
|
||||
uniform float uAlpha;
|
||||
uniform float uPickingAlphaThreshold;
|
||||
uniform int uPickable;
|
||||
uniform int uTransparentBackground;
|
||||
|
||||
uniform float uInteriorDarkening;
|
||||
|
||||
@@ -28,7 +28,6 @@ uniform sampler2D tMarker;
|
||||
|
||||
uniform float uAlpha;
|
||||
uniform float uPickingAlphaThreshold;
|
||||
uniform int uPickable;
|
||||
|
||||
#if defined(dGridTexType_2d)
|
||||
precision highp sampler2D;
|
||||
@@ -117,8 +116,6 @@ vec4 raymarch(vec3 startLoc, vec3 step, vec3 viewDir) {
|
||||
#if defined(dRenderVariant_pick)
|
||||
if (uAlpha < uPickingAlphaThreshold)
|
||||
discard; // ignore so the element below can be picked
|
||||
if (uPickable == 0)
|
||||
return vec4(0.0, 0.0, 0.0, 1.0); // set to empty picking id
|
||||
#endif
|
||||
|
||||
#if defined(dRenderVariant_pickObject)
|
||||
|
||||
@@ -35,20 +35,20 @@ varying float vInstance;
|
||||
const float C = 0.333;
|
||||
#endif
|
||||
|
||||
float cubicFilter( float x ){
|
||||
float cubicFilter(float x){
|
||||
float f = x;
|
||||
if( f < 0.0 ){
|
||||
if (f < 0.0) {
|
||||
f = -f;
|
||||
}
|
||||
if( f < 1.0 ){
|
||||
return ( ( 12.0 - 9.0 * B - 6.0 * C ) * ( f * f * f ) +
|
||||
( -18.0 + 12.0 * B + 6.0 *C ) * ( f * f ) +
|
||||
( 6.0 - 2.0 * B ) ) / 6.0;
|
||||
}else if( f >= 1.0 && f < 2.0 ){
|
||||
return ( ( -B - 6.0 * C ) * ( f * f * f )
|
||||
+ ( 6.0 * B + 30.0 * C ) * ( f *f ) +
|
||||
( - ( 12.0 * B ) - 48.0 * C ) * f +
|
||||
8.0 * B + 24.0 * C ) / 6.0;
|
||||
if (f < 1.0) {
|
||||
return ((12.0 - 9.0 * B - 6.0 * C) * (f * f * f) +
|
||||
(-18.0 + 12.0 * B + 6.0 * C) * (f * f) +
|
||||
(6.0 - 2.0 * B)) / 6.0;
|
||||
}else if (f >= 1.0 && f < 2.0){
|
||||
return ((-B - 6.0 * C) * ( f * f * f)
|
||||
+ (6.0 * B + 30.0 * C) * (f * f) +
|
||||
(-(12.0 * B) - 48.0 * C) * f +
|
||||
8.0 * B + 24.0 * C) / 6.0;
|
||||
}else{
|
||||
return 0.0;
|
||||
}
|
||||
@@ -92,25 +92,23 @@ void main() {
|
||||
#else
|
||||
vec4 imageData = texture2D(tImageTex, vUv);
|
||||
#endif
|
||||
imageData.a = clamp(imageData.a, 0.0, 1.0);
|
||||
if (imageData.a > 0.9) imageData.a = 1.0;
|
||||
|
||||
#if defined(dRenderVariant_pick)
|
||||
if (imageData.a < 0.3)
|
||||
discard;
|
||||
|
||||
if (uPickable == 1) {
|
||||
#if defined(dRenderVariant_pickObject)
|
||||
gl_FragColor = vec4(encodeFloatRGB(float(uObjectId)), 1.0);
|
||||
#elif defined(dRenderVariant_pickInstance)
|
||||
gl_FragColor = vec4(encodeFloatRGB(vInstance), 1.0);
|
||||
#elif defined(dRenderVariant_pickGroup)
|
||||
float group = texture2D(tGroupTex, vUv).r;
|
||||
gl_FragColor = vec4(encodeFloatRGB(group), 1.0);
|
||||
#endif
|
||||
} else {
|
||||
gl_FragColor = vec4(0.0, 0.0, 0.0, 1.0); // set to empty picking id
|
||||
}
|
||||
#if defined(dRenderVariant_pickObject)
|
||||
gl_FragColor = vec4(encodeFloatRGB(float(uObjectId)), 1.0);
|
||||
#elif defined(dRenderVariant_pickInstance)
|
||||
gl_FragColor = vec4(encodeFloatRGB(vInstance), 1.0);
|
||||
#elif defined(dRenderVariant_pickGroup)
|
||||
float group = texture2D(tGroupTex, vUv).r;
|
||||
gl_FragColor = vec4(encodeFloatRGB(group), 1.0);
|
||||
#endif
|
||||
#elif defined(dRenderVariant_depth)
|
||||
if (imageData.a < 0.01)
|
||||
if (imageData.a < 0.05)
|
||||
discard;
|
||||
|
||||
#ifdef enabledFragDepth
|
||||
@@ -119,7 +117,7 @@ void main() {
|
||||
gl_FragColor = packDepthToRGBA(gl_FragCoord.z);
|
||||
#endif
|
||||
#elif defined(dRenderVariant_color)
|
||||
if (imageData.a < 0.01)
|
||||
if (imageData.a < 0.05)
|
||||
discard;
|
||||
|
||||
gl_FragColor = imageData;
|
||||
|
||||
@@ -1,5 +1,5 @@
|
||||
|
||||
import Mol2 from '../mol2/parser';
|
||||
import { parseMol2 } from '../mol2/parser';
|
||||
|
||||
const Mol2String = `@<TRIPOS>MOLECULE
|
||||
5816
|
||||
@@ -246,7 +246,7 @@ GASTEIGER
|
||||
|
||||
describe('mol2 reader', () => {
|
||||
it('basic', async () => {
|
||||
const parsed = await Mol2(Mol2String).run();
|
||||
const parsed = await parseMol2(Mol2String, '').run();
|
||||
if (parsed.isError) {
|
||||
throw new Error(parsed.message);
|
||||
}
|
||||
@@ -297,7 +297,7 @@ describe('mol2 reader', () => {
|
||||
});
|
||||
|
||||
it('multiblocks', async () => {
|
||||
const parsed = await Mol2(Mol2StringMultiBlocks).run();
|
||||
const parsed = await parseMol2(Mol2StringMultiBlocks, '').run();
|
||||
if (parsed.isError) {
|
||||
throw new Error(parsed.message);
|
||||
}
|
||||
@@ -348,7 +348,7 @@ describe('mol2 reader', () => {
|
||||
});
|
||||
|
||||
it('minimal', async () => {
|
||||
const parsed = await Mol2(Mol2StringMinimal).run();
|
||||
const parsed = await parseMol2(Mol2StringMinimal, '').run();
|
||||
if (parsed.isError) {
|
||||
throw new Error(parsed.message);
|
||||
}
|
||||
|
||||
@@ -54,7 +54,7 @@ const reWhitespace = /\s+/g;
|
||||
function handleMolecule(state: State) {
|
||||
const { tokenizer, molecule } = state;
|
||||
|
||||
while (getTokenString(tokenizer) !== '@<TRIPOS>MOLECULE') {
|
||||
while (getTokenString(tokenizer) !== '@<TRIPOS>MOLECULE' && tokenizer.position < tokenizer.data.length) {
|
||||
markLine(tokenizer);
|
||||
}
|
||||
|
||||
@@ -101,7 +101,7 @@ async function handleAtoms(state: State): Promise<Schema.Mol2Atoms> {
|
||||
let hasStatus_bit = false;
|
||||
|
||||
// skip empty lines and '@<TRIPOS>ATOM'
|
||||
while (getTokenString(tokenizer) !== '@<TRIPOS>ATOM') {
|
||||
while (getTokenString(tokenizer) !== '@<TRIPOS>ATOM' && tokenizer.position < tokenizer.data.length) {
|
||||
markLine(tokenizer);
|
||||
}
|
||||
|
||||
@@ -243,7 +243,7 @@ async function handleBonds(state: State): Promise<Schema.Mol2Bonds> {
|
||||
const { tokenizer, molecule } = state;
|
||||
let hasStatus_bit = false;
|
||||
|
||||
while (getTokenString(tokenizer) !== '@<TRIPOS>BOND') {
|
||||
while (getTokenString(tokenizer) !== '@<TRIPOS>BOND' && tokenizer.position < tokenizer.data.length) {
|
||||
markLine(tokenizer);
|
||||
}
|
||||
|
||||
@@ -324,7 +324,7 @@ async function handleBonds(state: State): Promise<Schema.Mol2Bonds> {
|
||||
return ret;
|
||||
}
|
||||
|
||||
async function parseInternal(data: string, ctx: RuntimeContext): Promise<Result<Schema.Mol2File>> {
|
||||
async function parseInternal(ctx: RuntimeContext, data: string, name: string): Promise<Result<Schema.Mol2File>> {
|
||||
const tokenizer = Tokenizer(data);
|
||||
|
||||
ctx.update({ message: 'Parsing...', current: 0, max: data.length });
|
||||
@@ -335,16 +335,15 @@ async function parseInternal(data: string, ctx: RuntimeContext): Promise<Result<
|
||||
const atoms = await handleAtoms(state);
|
||||
const bonds = await handleBonds(state);
|
||||
structures.push({ molecule: state.molecule, atoms, bonds });
|
||||
skipWhitespace(tokenizer);
|
||||
}
|
||||
|
||||
const result: Schema.Mol2File = { structures };
|
||||
const result: Schema.Mol2File = { name, structures };
|
||||
return Result.success(result);
|
||||
}
|
||||
|
||||
export function parse(data: string) {
|
||||
export function parseMol2(data: string, name: string) {
|
||||
return Task.create<Result<Schema.Mol2File>>('Parse MOL2', async ctx => {
|
||||
return await parseInternal(data, ctx);
|
||||
return await parseInternal(ctx, data, name);
|
||||
});
|
||||
}
|
||||
|
||||
export default parse;
|
||||
}
|
||||
1
src/mol-io/reader/mol2/schema.d.ts
vendored
1
src/mol-io/reader/mol2/schema.d.ts
vendored
@@ -63,5 +63,6 @@ export interface Mol2Structure {
|
||||
}
|
||||
|
||||
export interface Mol2File {
|
||||
name: string
|
||||
structures: Mol2Structure[]
|
||||
}
|
||||
@@ -6,7 +6,7 @@
|
||||
|
||||
import { Model } from '../../mol-model/structure/model';
|
||||
import { Task } from '../../mol-task';
|
||||
import { ModelFormat } from './format';
|
||||
import { ModelFormat } from '../format';
|
||||
import { Column, Table } from '../../mol-data/db';
|
||||
import { EntityBuilder } from './common/entity';
|
||||
import { File3DG } from '../../mol-io/reader/3dg/parser';
|
||||
|
||||
@@ -16,7 +16,7 @@ import { ElementSymbol } from '../../../mol-model/structure/model/types';
|
||||
import { Entities } from '../../../mol-model/structure/model/properties/common';
|
||||
import { getAtomicDerivedData } from '../../../mol-model/structure/model/properties/utils/atomic-derived';
|
||||
import { AtomSite } from './schema';
|
||||
import { ModelFormat } from '../format';
|
||||
import { ModelFormat } from '../../format';
|
||||
import { SymmetryOperator } from '../../../mol-math/geometry';
|
||||
import { MmcifFormat } from '../mmcif';
|
||||
import { AtomSiteOperatorMappingSchema } from '../../../mol-model/structure/export/categories/atom_site_operator_mapping';
|
||||
|
||||
@@ -10,12 +10,12 @@ import { RuntimeContext } from '../../../mol-task';
|
||||
import UUID from '../../../mol-util/uuid';
|
||||
import { Model } from '../../../mol-model/structure/model/model';
|
||||
import { Entities } from '../../../mol-model/structure/model/properties/common';
|
||||
import { CustomProperties } from '../../../mol-model/structure';
|
||||
import { CustomProperties } from '../../../mol-model/custom-property';
|
||||
import { getAtomicHierarchyAndConformation } from './atomic';
|
||||
import { getCoarse, EmptyCoarse, CoarseData } from './coarse';
|
||||
import { getSequence } from './sequence';
|
||||
import { sortAtomSite } from './sort';
|
||||
import { ModelFormat } from '../format';
|
||||
import { ModelFormat } from '../../format';
|
||||
import { getAtomicRanges } from '../../../mol-model/structure/model/properties/utils/atomic-ranges';
|
||||
import { AtomSite, BasicData } from './schema';
|
||||
import { getProperties } from './properties';
|
||||
|
||||
@@ -12,7 +12,7 @@ import { createModels } from './basic/parser';
|
||||
import { BasicSchema, createBasic } from './basic/schema';
|
||||
import { ComponentBuilder } from './common/component';
|
||||
import { EntityBuilder } from './common/entity';
|
||||
import { ModelFormat } from './format';
|
||||
import { ModelFormat } from '../format';
|
||||
import { CifCore_Database } from '../../mol-io/reader/cif/schema/cif-core';
|
||||
import { CifFrame, CIF } from '../../mol-io/reader/cif';
|
||||
import { Spacegroup, SpacegroupCell } from '../../mol-math/geometry';
|
||||
|
||||
@@ -4,8 +4,9 @@
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { CustomPropertyDescriptor, Model } from '../../../mol-model/structure';
|
||||
import { ModelFormat } from '../format';
|
||||
import { Model } from '../../../mol-model/structure';
|
||||
import { ModelFormat } from '../../format';
|
||||
import { CustomPropertyDescriptor } from '../../../mol-model/custom-property';
|
||||
|
||||
class FormatRegistry<T> {
|
||||
private map = new Map<ModelFormat['kind'], (model: Model) => T | undefined>()
|
||||
|
||||
@@ -12,7 +12,7 @@ import { createModels } from './basic/parser';
|
||||
import { BasicSchema, createBasic } from './basic/schema';
|
||||
import { ComponentBuilder } from './common/component';
|
||||
import { EntityBuilder } from './common/entity';
|
||||
import { ModelFormat } from './format';
|
||||
import { ModelFormat } from '../format';
|
||||
import { CubeFile } from '../../mol-io/reader/cube/parser';
|
||||
|
||||
async function getModels(cube: CubeFile, ctx: RuntimeContext): Promise<Model[]> {
|
||||
|
||||
@@ -6,7 +6,7 @@
|
||||
|
||||
import { Model } from '../../mol-model/structure/model';
|
||||
import { Task } from '../../mol-task';
|
||||
import { ModelFormat } from './format';
|
||||
import { ModelFormat } from '../format';
|
||||
import { GroFile, GroAtoms } from '../../mol-io/reader/gro/schema';
|
||||
import { Column, Table } from '../../mol-data/db';
|
||||
import { guessElementSymbolString } from './util';
|
||||
|
||||
@@ -7,7 +7,7 @@
|
||||
|
||||
import { Model } from '../../mol-model/structure/model/model';
|
||||
import { Task } from '../../mol-task';
|
||||
import { ModelFormat } from './format';
|
||||
import { ModelFormat } from '../format';
|
||||
import { CifFrame, CIF } from '../../mol-io/reader/cif';
|
||||
import { mmCIF_Database } from '../../mol-io/reader/cif/schema/mmcif';
|
||||
import { createModels } from './basic/parser';
|
||||
|
||||
@@ -14,7 +14,7 @@ import { createModels } from './basic/parser';
|
||||
import { BasicSchema, createBasic } from './basic/schema';
|
||||
import { ComponentBuilder } from './common/component';
|
||||
import { EntityBuilder } from './common/entity';
|
||||
import { ModelFormat } from './format';
|
||||
import { ModelFormat } from '../format';
|
||||
import { IndexPairBonds } from './property/bonds/index-pair';
|
||||
|
||||
async function getModels(mol: MolFile, ctx: RuntimeContext): Promise<Model[]> {
|
||||
|
||||
98
src/mol-model-formats/structure/mol2.ts
Normal file
98
src/mol-model-formats/structure/mol2.ts
Normal file
@@ -0,0 +1,98 @@
|
||||
/**
|
||||
* Copyright (c) 2020 mol* contributors, licensed under MIT, See LICENSE file for more info.
|
||||
*
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { Column, Table } from '../../mol-data/db';
|
||||
import { Model } from '../../mol-model/structure/model';
|
||||
import { MoleculeType } from '../../mol-model/structure/model/types';
|
||||
import { RuntimeContext, Task } from '../../mol-task';
|
||||
import { createModels } from './basic/parser';
|
||||
import { BasicSchema, createBasic } from './basic/schema';
|
||||
import { ComponentBuilder } from './common/component';
|
||||
import { EntityBuilder } from './common/entity';
|
||||
import { ModelFormat } from '../format';
|
||||
import { IndexPairBonds } from './property/bonds/index-pair';
|
||||
import { Mol2File } from '../../mol-io/reader/mol2/schema';
|
||||
|
||||
async function getModels(mol2: Mol2File, ctx: RuntimeContext): Promise<Model[]> {
|
||||
const models: Model[] = [];
|
||||
|
||||
for (let i = 0, il = mol2.structures.length; i < il; ++i) {
|
||||
const { atoms, bonds } = mol2.structures[i];
|
||||
|
||||
const A = Column.ofConst('A', atoms.count, Column.Schema.str);
|
||||
|
||||
const atom_site = Table.ofPartialColumns(BasicSchema.atom_site, {
|
||||
auth_asym_id: A,
|
||||
auth_atom_id: Column.asArrayColumn(atoms.atom_type),
|
||||
auth_comp_id: atoms.subst_name,
|
||||
auth_seq_id: atoms.subst_id,
|
||||
Cartn_x: Column.asArrayColumn(atoms.x, Float32Array),
|
||||
Cartn_y: Column.asArrayColumn(atoms.y, Float32Array),
|
||||
Cartn_z: Column.asArrayColumn(atoms.z, Float32Array),
|
||||
id: Column.asArrayColumn(atoms.atom_id),
|
||||
|
||||
label_asym_id: A,
|
||||
label_atom_id: Column.asArrayColumn(atoms.atom_type),
|
||||
label_comp_id: atoms.subst_name,
|
||||
label_seq_id: atoms.subst_id,
|
||||
label_entity_id: Column.ofConst('1', atoms.count, Column.Schema.str),
|
||||
|
||||
occupancy: Column.ofConst(1, atoms.count, Column.Schema.float),
|
||||
type_symbol: Column.asArrayColumn(atoms.atom_name),
|
||||
|
||||
pdbx_PDB_model_num: Column.ofConst(i, atoms.count, Column.Schema.int),
|
||||
}, atoms.count);
|
||||
|
||||
const entityBuilder = new EntityBuilder();
|
||||
entityBuilder.setNames([['MOL', 'Unknown Entity']]);
|
||||
entityBuilder.getEntityId('MOL', MoleculeType.Unknown, 'A');
|
||||
|
||||
const componentBuilder = new ComponentBuilder(atoms.subst_id, atoms.atom_name);
|
||||
for (let i = 0, il = atoms.subst_name.rowCount; i < il; ++i) {
|
||||
componentBuilder.add(atoms.subst_name.value(i), i);
|
||||
}
|
||||
|
||||
const basics = createBasic({
|
||||
entity: entityBuilder.getEntityTable(),
|
||||
chem_comp: componentBuilder.getChemCompTable(),
|
||||
atom_site
|
||||
});
|
||||
|
||||
const _models = await createModels(basics, Mol2Format.create(mol2), ctx);
|
||||
|
||||
if (_models.length > 0) {
|
||||
const indexA = Column.ofIntArray(Column.mapToArray(bonds.origin_atom_id, x => x - 1, Int32Array));
|
||||
const indexB = Column.ofIntArray(Column.mapToArray(bonds.target_atom_id, x => x - 1, Int32Array));
|
||||
const order = Column.ofIntArray(Column.mapToArray(bonds.bond_type, x => x === 'ar' ? 1 : parseInt(x), Int8Array));
|
||||
const pairBonds = IndexPairBonds.fromData({ pairs: { indexA, indexB, order }, count: bonds.count });
|
||||
IndexPairBonds.Provider.set(_models[0], pairBonds);
|
||||
|
||||
models.push(_models[0]);
|
||||
}
|
||||
}
|
||||
|
||||
return models;
|
||||
}
|
||||
|
||||
//
|
||||
|
||||
export { Mol2Format };
|
||||
|
||||
type Mol2Format = ModelFormat<Mol2File>
|
||||
|
||||
namespace Mol2Format {
|
||||
export function is(x: ModelFormat): x is Mol2Format {
|
||||
return x.kind === 'mol2';
|
||||
}
|
||||
|
||||
export function create(mol2: Mol2File): Mol2Format {
|
||||
return { kind: 'mol2', name: mol2.name, data: mol2 };
|
||||
}
|
||||
}
|
||||
|
||||
export function trajectoryFromMol2(mol2: Mol2File): Task<Model.Trajectory> {
|
||||
return Task.create('Parse MOL2', ctx => getModels(mol2, ctx));
|
||||
}
|
||||
@@ -5,7 +5,7 @@
|
||||
*/
|
||||
|
||||
import { Table, Column } from '../../../mol-data/db';
|
||||
import { CustomPropertyDescriptor } from '../../../mol-model/structure';
|
||||
import { CustomPropertyDescriptor } from '../../../mol-model/custom-property';
|
||||
import { mmCIF_Schema } from '../../../mol-io/reader/cif/schema/mmcif';
|
||||
import { CifWriter } from '../../../mol-io/writer/cif';
|
||||
import { FormatPropertyProvider } from '../common/property';
|
||||
|
||||
@@ -7,7 +7,7 @@
|
||||
|
||||
import { Model } from '../../../../mol-model/structure/model/model';
|
||||
import { BondType } from '../../../../mol-model/structure/model/types';
|
||||
import { CustomPropertyDescriptor } from '../../../../mol-model/structure';
|
||||
import { CustomPropertyDescriptor } from '../../../../mol-model/custom-property';
|
||||
import { mmCIF_Schema } from '../../../../mol-io/reader/cif/schema/mmcif';
|
||||
import { CifWriter } from '../../../../mol-io/writer/cif';
|
||||
import { Table } from '../../../../mol-data/db';
|
||||
|
||||
@@ -4,7 +4,7 @@
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { CustomPropertyDescriptor } from '../../../../mol-model/structure';
|
||||
import { CustomPropertyDescriptor } from '../../../../mol-model/custom-property';
|
||||
import { IntAdjacencyGraph } from '../../../../mol-math/graph';
|
||||
import { Column } from '../../../../mol-data/db';
|
||||
import { FormatPropertyProvider } from '../../common/property';
|
||||
|
||||
@@ -9,7 +9,7 @@ import { Model } from '../../../../mol-model/structure/model/model';
|
||||
import { Structure } from '../../../../mol-model/structure';
|
||||
import { BondType } from '../../../../mol-model/structure/model/types';
|
||||
import { Column, Table } from '../../../../mol-data/db';
|
||||
import { CustomPropertyDescriptor } from '../../../../mol-model/structure';
|
||||
import { CustomPropertyDescriptor } from '../../../../mol-model/custom-property';
|
||||
import { mmCIF_Schema } from '../../../../mol-io/reader/cif/schema/mmcif';
|
||||
import { SortedArray } from '../../../../mol-data/int';
|
||||
import { CifWriter } from '../../../../mol-io/writer/cif';
|
||||
|
||||
@@ -13,7 +13,7 @@ import { SecondaryStructure } from '../../../mol-model/structure/model/propertie
|
||||
import { Column, Table } from '../../../mol-data/db';
|
||||
import { ChainIndex, ResidueIndex } from '../../../mol-model/structure/model/indexing';
|
||||
import { FormatPropertyProvider } from '../common/property';
|
||||
import { CustomPropertyDescriptor } from '../../../mol-model/structure';
|
||||
import { CustomPropertyDescriptor } from '../../../mol-model/custom-property';
|
||||
|
||||
export { ModelSecondaryStructure };
|
||||
|
||||
|
||||
@@ -10,7 +10,7 @@ import { Spacegroup, SpacegroupCell, SymmetryOperator } from '../../../mol-math/
|
||||
import { Tensor, Vec3, Mat3 } from '../../../mol-math/linear-algebra';
|
||||
import { Symmetry } from '../../../mol-model/structure/model/properties/symmetry';
|
||||
import { createAssemblies } from './assembly';
|
||||
import { CustomPropertyDescriptor } from '../../../mol-model/structure';
|
||||
import { CustomPropertyDescriptor } from '../../../mol-model/custom-property';
|
||||
import { FormatPropertyProvider } from '../common/property';
|
||||
import { Table } from '../../../mol-data/db';
|
||||
|
||||
|
||||
@@ -12,7 +12,7 @@ import { guessElementSymbolString } from './util';
|
||||
import { MoleculeType, getMoleculeType } from '../../mol-model/structure/model/types';
|
||||
import { getChainId } from './common/util';
|
||||
import { Task } from '../../mol-task';
|
||||
import { ModelFormat } from './format';
|
||||
import { ModelFormat } from '../format';
|
||||
import { Topology } from '../../mol-model/structure/topology/topology';
|
||||
import { createBasic, BasicSchema } from './basic/schema';
|
||||
|
||||
|
||||
@@ -4,7 +4,7 @@
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { VolumeData } from '../../mol-model/volume/data';
|
||||
import { Volume } from '../../mol-model/volume';
|
||||
import { Task } from '../../mol-task';
|
||||
import { SpacegroupCell, Box3D } from '../../mol-math/geometry';
|
||||
import { Tensor, Vec3 } from '../../mol-math/linear-algebra';
|
||||
@@ -13,6 +13,8 @@ import { degToRad } from '../../mol-math/misc';
|
||||
import { getCcp4ValueType } from '../../mol-io/reader/ccp4/parser';
|
||||
import { TypedArrayValueType } from '../../mol-io/common/typed-array';
|
||||
import { arrayMin, arrayRms, arrayMean, arrayMax } from '../../mol-util/array';
|
||||
import { ModelFormat } from '../format';
|
||||
import { CustomProperties } from '../../mol-model/custom-property';
|
||||
|
||||
/** When available (e.g. in MRC files) use ORIGIN records instead of N[CRS]START */
|
||||
export function getCcp4Origin(header: Ccp4Header): Vec3 {
|
||||
@@ -38,8 +40,8 @@ function getTypedArrayCtor(header: Ccp4Header) {
|
||||
throw Error(`${valueType} is not a supported value format.`);
|
||||
}
|
||||
|
||||
export function volumeFromCcp4(source: Ccp4File, params?: { voxelSize?: Vec3, offset?: Vec3, label?: string }): Task<VolumeData> {
|
||||
return Task.create<VolumeData>('Create Volume Data', async ctx => {
|
||||
export function volumeFromCcp4(source: Ccp4File, params?: { voxelSize?: Vec3, offset?: Vec3, label?: string }): Task<Volume> {
|
||||
return Task.create<Volume>('Create Volume', async ctx => {
|
||||
const { header, values } = source;
|
||||
const size = Vec3.create(header.xLength, header.yLength, header.zLength);
|
||||
if (params && params.voxelSize) Vec3.mul(size, size, params.voxelSize);
|
||||
@@ -68,14 +70,35 @@ export function volumeFromCcp4(source: Ccp4File, params?: { voxelSize?: Vec3, of
|
||||
|
||||
return {
|
||||
label: params?.label,
|
||||
transform: { kind: 'spacegroup', cell, fractionalBox: Box3D.create(origin_frac, Vec3.add(Vec3.zero(), origin_frac, dimensions_frac)) },
|
||||
data,
|
||||
dataStats: {
|
||||
min: isNaN(header.AMIN) ? arrayMin(values) : header.AMIN,
|
||||
max: isNaN(header.AMAX) ? arrayMax(values) : header.AMAX,
|
||||
mean: isNaN(header.AMEAN) ? arrayMean(values) : header.AMEAN,
|
||||
sigma: (isNaN(header.ARMS) || header.ARMS === 0) ? arrayRms(values) : header.ARMS
|
||||
}
|
||||
grid: {
|
||||
transform: { kind: 'spacegroup', cell, fractionalBox: Box3D.create(origin_frac, Vec3.add(Vec3.zero(), origin_frac, dimensions_frac)) },
|
||||
cells: data,
|
||||
stats: {
|
||||
min: isNaN(header.AMIN) ? arrayMin(values) : header.AMIN,
|
||||
max: isNaN(header.AMAX) ? arrayMax(values) : header.AMAX,
|
||||
mean: isNaN(header.AMEAN) ? arrayMean(values) : header.AMEAN,
|
||||
sigma: (isNaN(header.ARMS) || header.ARMS === 0) ? arrayRms(values) : header.ARMS
|
||||
},
|
||||
},
|
||||
sourceData: Ccp4Format.create(source),
|
||||
customProperties: new CustomProperties(),
|
||||
_propertyData: Object.create(null),
|
||||
};
|
||||
});
|
||||
}
|
||||
|
||||
//
|
||||
|
||||
export { Ccp4Format };
|
||||
|
||||
type Ccp4Format = ModelFormat<Ccp4File>
|
||||
|
||||
namespace Ccp4Format {
|
||||
export function is(x: ModelFormat): x is Ccp4Format {
|
||||
return x.kind === 'ccp4';
|
||||
}
|
||||
|
||||
export function create(ccp4: Ccp4File): Ccp4Format {
|
||||
return { kind: 'ccp4', name: ccp4.name, data: ccp4 };
|
||||
}
|
||||
}
|
||||
@@ -6,12 +6,14 @@
|
||||
|
||||
import { CubeFile } from '../../mol-io/reader/cube/parser';
|
||||
import { Mat4, Tensor } from '../../mol-math/linear-algebra';
|
||||
import { VolumeData } from '../../mol-model/volume/data';
|
||||
import { Volume } from '../../mol-model/volume';
|
||||
import { Task } from '../../mol-task';
|
||||
import { arrayMax, arrayMean, arrayMin, arrayRms } from '../../mol-util/array';
|
||||
import { ModelFormat } from '../format';
|
||||
import { CustomProperties } from '../../mol-model/custom-property';
|
||||
|
||||
export function volumeFromCube(source: CubeFile, params?: { dataIndex?: number, label?: string }): Task<VolumeData> {
|
||||
return Task.create<VolumeData>('Create Volume Data', async () => {
|
||||
export function volumeFromCube(source: CubeFile, params?: { dataIndex?: number, label?: string }): Task<Volume> {
|
||||
return Task.create<Volume>('Create Volume', async () => {
|
||||
const { header, values: sourceValues } = source;
|
||||
const space = Tensor.Space(header.dim, [0, 1, 2], Float64Array);
|
||||
|
||||
@@ -44,14 +46,35 @@ export function volumeFromCube(source: CubeFile, params?: { dataIndex?: number,
|
||||
|
||||
return {
|
||||
label: params?.label,
|
||||
transform: { kind: 'matrix', matrix },
|
||||
data,
|
||||
dataStats: {
|
||||
min: arrayMin(values),
|
||||
max: arrayMax(values),
|
||||
mean: arrayMean(values),
|
||||
sigma: arrayRms(values)
|
||||
}
|
||||
grid: {
|
||||
transform: { kind: 'matrix', matrix },
|
||||
cells: data,
|
||||
stats: {
|
||||
min: arrayMin(values),
|
||||
max: arrayMax(values),
|
||||
mean: arrayMean(values),
|
||||
sigma: arrayRms(values)
|
||||
},
|
||||
},
|
||||
sourceData: CubeFormat.create(source),
|
||||
customProperties: new CustomProperties(),
|
||||
_propertyData: Object.create(null),
|
||||
};
|
||||
});
|
||||
}
|
||||
|
||||
//
|
||||
|
||||
export { CubeFormat };
|
||||
|
||||
type CubeFormat = ModelFormat<CubeFile>
|
||||
|
||||
namespace CubeFormat {
|
||||
export function is(x: ModelFormat): x is CubeFormat {
|
||||
return x.kind === 'cube';
|
||||
}
|
||||
|
||||
export function create(cube: CubeFile): CubeFormat {
|
||||
return { kind: 'cube', name: cube.name, data: cube };
|
||||
}
|
||||
}
|
||||
@@ -5,13 +5,15 @@
|
||||
*/
|
||||
|
||||
import { DensityServer_Data_Database } from '../../mol-io/reader/cif/schema/density-server';
|
||||
import { VolumeData } from '../../mol-model/volume/data';
|
||||
import { Volume } from '../../mol-model/volume';
|
||||
import { Task } from '../../mol-task';
|
||||
import { SpacegroupCell, Box3D } from '../../mol-math/geometry';
|
||||
import { Tensor, Vec3 } from '../../mol-math/linear-algebra';
|
||||
import { ModelFormat } from '../format';
|
||||
import { CustomProperties } from '../../mol-model/custom-property';
|
||||
|
||||
function volumeFromDensityServerData(source: DensityServer_Data_Database): Task<VolumeData> {
|
||||
return Task.create<VolumeData>('Create Volume Data', async ctx => {
|
||||
export function volumeFromDensityServerData(source: DensityServer_Data_Database): Task<Volume> {
|
||||
return Task.create<Volume>('Create Volume', async ctx => {
|
||||
const { volume_data_3d_info: info, volume_data_3d: values } = source;
|
||||
const cell = SpacegroupCell.create(
|
||||
info.spacegroup_number.value(0),
|
||||
@@ -34,16 +36,35 @@ function volumeFromDensityServerData(source: DensityServer_Data_Database): Task<
|
||||
const dimensions = Vec3.ofArray(normalizeOrder(info.dimensions.value(0)));
|
||||
|
||||
return {
|
||||
transform: { kind: 'spacegroup', cell, fractionalBox: Box3D.create(origin, Vec3.add(Vec3.zero(), origin, dimensions)) },
|
||||
data,
|
||||
dataStats: {
|
||||
min: info.min_sampled.value(0),
|
||||
max: info.max_sampled.value(0),
|
||||
mean: info.mean_sampled.value(0),
|
||||
sigma: info.sigma_sampled.value(0)
|
||||
}
|
||||
grid: {
|
||||
transform: { kind: 'spacegroup', cell, fractionalBox: Box3D.create(origin, Vec3.add(Vec3.zero(), origin, dimensions)) },
|
||||
cells: data,
|
||||
stats: {
|
||||
min: info.min_sampled.value(0),
|
||||
max: info.max_sampled.value(0),
|
||||
mean: info.mean_sampled.value(0),
|
||||
sigma: info.sigma_sampled.value(0)
|
||||
},
|
||||
},
|
||||
sourceData: DscifFormat.create(source),
|
||||
customProperties: new CustomProperties(),
|
||||
_propertyData: Object.create(null),
|
||||
};
|
||||
});
|
||||
}
|
||||
|
||||
export { volumeFromDensityServerData };
|
||||
//
|
||||
|
||||
export { DscifFormat };
|
||||
|
||||
type DscifFormat = ModelFormat<DensityServer_Data_Database>
|
||||
|
||||
namespace DscifFormat {
|
||||
export function is(x: ModelFormat): x is DscifFormat {
|
||||
return x.kind === 'dscif';
|
||||
}
|
||||
|
||||
export function create(dscif: DensityServer_Data_Database): DscifFormat {
|
||||
return { kind: 'dscif', name: dscif._name, data: dscif };
|
||||
}
|
||||
}
|
||||
@@ -4,16 +4,18 @@
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { VolumeData } from '../../mol-model/volume/data';
|
||||
import { Volume } from '../../mol-model/volume';
|
||||
import { Task } from '../../mol-task';
|
||||
import { SpacegroupCell, Box3D } from '../../mol-math/geometry';
|
||||
import { Tensor, Vec3 } from '../../mol-math/linear-algebra';
|
||||
import { degToRad } from '../../mol-math/misc';
|
||||
import { Dsn6File } from '../../mol-io/reader/dsn6/schema';
|
||||
import { arrayMin, arrayMax, arrayMean, arrayRms } from '../../mol-util/array';
|
||||
import { ModelFormat } from '../format';
|
||||
import { CustomProperties } from '../../mol-model/custom-property';
|
||||
|
||||
function volumeFromDsn6(source: Dsn6File, params?: { voxelSize?: Vec3, label?: string }): Task<VolumeData> {
|
||||
return Task.create<VolumeData>('Create Volume Data', async ctx => {
|
||||
export function volumeFromDsn6(source: Dsn6File, params?: { voxelSize?: Vec3, label?: string }): Task<Volume> {
|
||||
return Task.create<Volume>('Create Volume', async ctx => {
|
||||
const { header, values } = source;
|
||||
const size = Vec3.create(header.xlen, header.ylen, header.zlen);
|
||||
if (params && params.voxelSize) Vec3.mul(size, size, params.voxelSize);
|
||||
@@ -33,16 +35,35 @@ function volumeFromDsn6(source: Dsn6File, params?: { voxelSize?: Vec3, label?: s
|
||||
|
||||
return {
|
||||
label: params?.label,
|
||||
transform: { kind: 'spacegroup', cell, fractionalBox: Box3D.create(origin_frac, Vec3.add(Vec3.zero(), origin_frac, dimensions_frac)) },
|
||||
data,
|
||||
dataStats: {
|
||||
min: arrayMin(values),
|
||||
max: arrayMax(values),
|
||||
mean: arrayMean(values),
|
||||
sigma: header.sigma !== undefined ? header.sigma : arrayRms(values)
|
||||
}
|
||||
grid: {
|
||||
transform: { kind: 'spacegroup', cell, fractionalBox: Box3D.create(origin_frac, Vec3.add(Vec3.zero(), origin_frac, dimensions_frac)) },
|
||||
cells: data,
|
||||
stats: {
|
||||
min: arrayMin(values),
|
||||
max: arrayMax(values),
|
||||
mean: arrayMean(values),
|
||||
sigma: header.sigma !== undefined ? header.sigma : arrayRms(values)
|
||||
},
|
||||
},
|
||||
sourceData: Dsn6Format.create(source),
|
||||
customProperties: new CustomProperties(),
|
||||
_propertyData: Object.create(null),
|
||||
};
|
||||
});
|
||||
}
|
||||
|
||||
export { volumeFromDsn6 };
|
||||
//
|
||||
|
||||
export { Dsn6Format };
|
||||
|
||||
type Dsn6Format = ModelFormat<Dsn6File>
|
||||
|
||||
namespace Dsn6Format {
|
||||
export function is(x: ModelFormat): x is Dsn6Format {
|
||||
return x.kind === 'dsn6';
|
||||
}
|
||||
|
||||
export function create(dsn6: Dsn6File): Dsn6Format {
|
||||
return { kind: 'dsn6', name: dsn6.name, data: dsn6 };
|
||||
}
|
||||
}
|
||||
@@ -6,12 +6,14 @@
|
||||
|
||||
import { DxFile } from '../../mol-io/reader/dx/parser';
|
||||
import { Mat4, Tensor } from '../../mol-math/linear-algebra';
|
||||
import { VolumeData } from '../../mol-model/volume/data';
|
||||
import { Volume } from '../../mol-model/volume';
|
||||
import { Task } from '../../mol-task';
|
||||
import { arrayMax, arrayMean, arrayMin, arrayRms } from '../../mol-util/array';
|
||||
import { ModelFormat } from '../format';
|
||||
import { CustomProperties } from '../../mol-model/custom-property';
|
||||
|
||||
export function volumeFromDx(source: DxFile, params?: { label?: string }): Task<VolumeData> {
|
||||
return Task.create<VolumeData>('Create Volume Data', async () => {
|
||||
export function volumeFromDx(source: DxFile, params?: { label?: string }): Task<Volume> {
|
||||
return Task.create<Volume>('Create Volume', async () => {
|
||||
const { header, values } = source;
|
||||
const space = Tensor.Space(header.dim, [0, 1, 2], Float64Array);
|
||||
const data = Tensor.create(space, Tensor.Data1(values));
|
||||
@@ -21,14 +23,35 @@ export function volumeFromDx(source: DxFile, params?: { label?: string }): Task<
|
||||
|
||||
return {
|
||||
label: params?.label,
|
||||
transform: { kind: 'matrix', matrix },
|
||||
data,
|
||||
dataStats: {
|
||||
min: arrayMin(values),
|
||||
max: arrayMax(values),
|
||||
mean: arrayMean(values),
|
||||
sigma: arrayRms(values)
|
||||
}
|
||||
grid: {
|
||||
transform: { kind: 'matrix', matrix },
|
||||
cells: data,
|
||||
stats: {
|
||||
min: arrayMin(values),
|
||||
max: arrayMax(values),
|
||||
mean: arrayMean(values),
|
||||
sigma: arrayRms(values)
|
||||
},
|
||||
},
|
||||
sourceData: DxFormat.create(source),
|
||||
customProperties: new CustomProperties(),
|
||||
_propertyData: Object.create(null),
|
||||
};
|
||||
});
|
||||
}
|
||||
|
||||
//
|
||||
|
||||
export { DxFormat };
|
||||
|
||||
type DxFormat = ModelFormat<DxFile>
|
||||
|
||||
namespace DxFormat {
|
||||
export function is(x: ModelFormat): x is DxFormat {
|
||||
return x.kind === 'dx';
|
||||
}
|
||||
|
||||
export function create(dx: DxFile): DxFormat {
|
||||
return { kind: 'dx', name: dx.name, data: dx };
|
||||
}
|
||||
}
|
||||
@@ -5,7 +5,7 @@
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { ElementIndex, Model, CustomPropertyDescriptor } from '../../mol-model/structure';
|
||||
import { ElementIndex, Model } from '../../mol-model/structure';
|
||||
import { StructureElement } from '../../mol-model/structure/structure';
|
||||
import { Location } from '../../mol-model/location';
|
||||
import { ThemeDataContext } from '../../mol-theme/theme';
|
||||
@@ -16,6 +16,7 @@ import { OrderedSet } from '../../mol-data/int';
|
||||
import { CustomModelProperty } from './custom-model-property';
|
||||
import { CustomProperty } from './custom-property';
|
||||
import { LociLabelProvider } from '../../mol-plugin-state/manager/loci-label';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/custom-property';
|
||||
|
||||
export { CustomElementProperty };
|
||||
|
||||
|
||||
@@ -4,10 +4,11 @@
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { CustomPropertyDescriptor, Model } from '../../mol-model/structure';
|
||||
import { Model } from '../../mol-model/structure';
|
||||
import { ParamDefinition as PD } from '../../mol-util/param-definition';
|
||||
import { ValueBox } from '../../mol-util';
|
||||
import { CustomProperty } from './custom-property';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/custom-property';
|
||||
|
||||
export { CustomModelProperty };
|
||||
|
||||
|
||||
@@ -5,7 +5,7 @@
|
||||
*/
|
||||
|
||||
import { RuntimeContext } from '../../mol-task';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/structure';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/custom-property';
|
||||
import { ParamDefinition as PD } from '../../mol-util/param-definition';
|
||||
import { ValueBox } from '../../mol-util';
|
||||
import { OrderedMap } from 'immutable';
|
||||
|
||||
@@ -4,10 +4,11 @@
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { CustomPropertyDescriptor, Structure } from '../../mol-model/structure';
|
||||
import { Structure } from '../../mol-model/structure';
|
||||
import { ParamDefinition as PD } from '../../mol-util/param-definition';
|
||||
import { ValueBox } from '../../mol-util';
|
||||
import { CustomProperty } from './custom-property';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/custom-property';
|
||||
|
||||
export { CustomStructureProperty };
|
||||
|
||||
|
||||
@@ -7,12 +7,13 @@
|
||||
|
||||
import { ParamDefinition as PD } from '../../mol-util/param-definition';
|
||||
import { ShrakeRupleyComputationParams, AccessibleSurfaceArea } from './accessible-surface-area/shrake-rupley';
|
||||
import { Structure, CustomPropertyDescriptor, Unit } from '../../mol-model/structure';
|
||||
import { Structure, Unit } from '../../mol-model/structure';
|
||||
import { CustomStructureProperty } from '../common/custom-structure-property';
|
||||
import { CustomProperty } from '../common/custom-property';
|
||||
import { QuerySymbolRuntime } from '../../mol-script/runtime/query/compiler';
|
||||
import { CustomPropSymbol } from '../../mol-script/language/symbol';
|
||||
import Type from '../../mol-script/language/type';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/custom-property';
|
||||
|
||||
export const AccessibleSurfaceAreaParams = {
|
||||
...ShrakeRupleyComputationParams
|
||||
|
||||
@@ -4,11 +4,12 @@
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { CustomPropertyDescriptor, Structure } from '../../mol-model/structure';
|
||||
import { Structure } from '../../mol-model/structure';
|
||||
import { ParamDefinition as PD } from '../../mol-util/param-definition';
|
||||
import { computeInteractions, Interactions, InteractionsParams as _InteractionsParams } from './interactions/interactions';
|
||||
import { CustomStructureProperty } from '../common/custom-structure-property';
|
||||
import { CustomProperty } from '../common/custom-property';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/custom-property';
|
||||
|
||||
export const InteractionsParams = {
|
||||
..._InteractionsParams
|
||||
|
||||
@@ -12,7 +12,7 @@ import { Unit } from '../../mol-model/structure/structure';
|
||||
import { CustomStructureProperty } from '../common/custom-structure-property';
|
||||
import { CustomProperty } from '../common/custom-property';
|
||||
import { ModelSecondaryStructure } from '../../mol-model-formats/structure/property/secondary-structure';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/structure/common/custom-property';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/custom-property';
|
||||
import { Model } from '../../mol-model/structure/model';
|
||||
|
||||
function getSecondaryStructureParams(data?: Structure) {
|
||||
|
||||
@@ -4,11 +4,12 @@
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { CustomPropertyDescriptor, Structure } from '../../mol-model/structure';
|
||||
import { Structure } from '../../mol-model/structure';
|
||||
import { ParamDefinition as PD } from '../../mol-util/param-definition';
|
||||
import { calcValenceModel, ValenceModel, ValenceModelParams as _ValenceModelParams } from './chemistry/valence-model';
|
||||
import { CustomStructureProperty } from '../common/custom-structure-property';
|
||||
import { CustomProperty } from '../common/custom-property';
|
||||
import { CustomPropertyDescriptor } from '../../mol-model/custom-property';
|
||||
|
||||
export const ValenceModelParams = {
|
||||
..._ValenceModelParams
|
||||
|
||||
@@ -7,9 +7,10 @@
|
||||
import { Model } from '../../../mol-model/structure/model/model';
|
||||
import { Table } from '../../../mol-data/db';
|
||||
import { mmCIF_Schema } from '../../../mol-io/reader/cif/schema/mmcif';
|
||||
import { Unit, CustomPropertyDescriptor } from '../../../mol-model/structure';
|
||||
import { Unit } from '../../../mol-model/structure';
|
||||
import { ElementIndex } from '../../../mol-model/structure/model/indexing';
|
||||
import { FormatPropertyProvider } from '../../../mol-model-formats/structure/common/property';
|
||||
import { CustomPropertyDescriptor } from '../../../mol-model/custom-property';
|
||||
|
||||
export { ModelCrossLinkRestraint };
|
||||
|
||||
|
||||
@@ -5,7 +5,7 @@
|
||||
*/
|
||||
|
||||
import { ModelCrossLinkRestraint } from './format';
|
||||
import { Unit, StructureElement, Structure, CustomPropertyDescriptor, Bond} from '../../../mol-model/structure';
|
||||
import { Unit, StructureElement, Structure, Bond} from '../../../mol-model/structure';
|
||||
import { PairRestraints, PairRestraint } from '../pair-restraints';
|
||||
import { CustomStructureProperty } from '../../common/custom-structure-property';
|
||||
import { CustomProperty } from '../../common/custom-property';
|
||||
@@ -15,6 +15,7 @@ import { Sphere3D } from '../../../mol-math/geometry';
|
||||
import { CentroidHelper } from '../../../mol-math/geometry/centroid-helper';
|
||||
import { bondLabel } from '../../../mol-theme/label';
|
||||
import { Vec3 } from '../../../mol-math/linear-algebra';
|
||||
import { CustomPropertyDescriptor } from '../../../mol-model/custom-property';
|
||||
|
||||
export type CrossLinkRestraintValue = PairRestraints<CrossLinkRestraint>
|
||||
|
||||
|
||||
@@ -5,11 +5,11 @@
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { CifWriter } from '../../../mol-io/writer/cif';
|
||||
import { CifExportContext } from '../export/mmcif';
|
||||
import { QuerySymbolRuntime } from '../../../mol-script/runtime/query/compiler';
|
||||
import { UUID } from '../../../mol-util';
|
||||
import { Asset } from '../../../mol-util/assets';
|
||||
import { CifWriter } from '../mol-io/writer/cif';
|
||||
import { CifExportContext } from './structure/export/mmcif';
|
||||
import { QuerySymbolRuntime } from '../mol-script/runtime/query/compiler';
|
||||
import { UUID } from '../mol-util';
|
||||
import { Asset } from '../mol-util/assets';
|
||||
|
||||
export { CustomPropertyDescriptor, CustomProperties };
|
||||
|
||||
@@ -255,11 +255,12 @@ namespace Loci {
|
||||
};
|
||||
export type Granularity = keyof typeof Granularity
|
||||
export const GranularityOptions = ParamDefinition.objectToOptions(Granularity, k => {
|
||||
if (k.indexOf('Instances') > 0) return [stringToWords(k), 'With Symmetry'];
|
||||
switch (k) {
|
||||
case 'element': return'Atom/Coarse Element';
|
||||
case 'elementInstances': return ['Atom/Coarse Element Instances', 'With Symmetry'];
|
||||
case 'structure': return'Structure/Shape';
|
||||
default: return stringToWords(k);
|
||||
default: return k.indexOf('Instances')
|
||||
? [stringToWords(k), 'With Symmetry'] : stringToWords(k);
|
||||
}
|
||||
});
|
||||
|
||||
|
||||
0
src/mol-model/sequence/alignment.ts
Normal file
0
src/mol-model/sequence/alignment.ts
Normal file
26
src/mol-model/sequence/alignment/_spec/alignment.spec.ts
Normal file
26
src/mol-model/sequence/alignment/_spec/alignment.spec.ts
Normal file
@@ -0,0 +1,26 @@
|
||||
/**
|
||||
* Copyright (c) 2020 mol* contributors, licensed under MIT, See LICENSE file for more info.
|
||||
*
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { align } from '../alignment';
|
||||
|
||||
describe('Alignment', () => {
|
||||
it('basic', () => {
|
||||
// 3PQR: Rhodopsin
|
||||
const seqA = 'MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA';
|
||||
// 3SN6: Endolysin,Beta-2 adrenergic
|
||||
const seqB = 'DYKDDDDAENLYFQGNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYAADEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILTKTWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYAEETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSG';
|
||||
|
||||
const { aliA, aliB, score } = align(seqA, seqB, {
|
||||
gapPenalty: -11,
|
||||
gapExtensionPenalty: -1,
|
||||
substMatrix: 'blosum62'
|
||||
});
|
||||
|
||||
expect(aliA).toEqual('------------------------------------------------------------------------------------------------------------------------------------------------MNGTEGPNFYVPFSNKTGVVRSPFEA---PQYYLAEPWQFSM--LAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLH---GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMS-NFRFGENHAIMGVAFTWVMA-LACAAPPLVGWSRYI-PEGMQC----SCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLV----------------FTVKEAAAQQQESATTQ----------KAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA');
|
||||
expect(aliB).toEqual('DYKDDDDAENLYFQGNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKS-RWYNQTPNRAKRVITTFRTGTWDAYAADEVWVVGMGIVMSLIVLAIVFG---NVLVITAIAKFERLQTVTNYFITSLACADLVM---GLAVVPFGAAHILTKTWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYAEETC-CDFFT------NQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMG-TFTLCWLPFF-IVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIY-CRSPDFRIAFQELLCLRRSSL--KAYGNGYSSNGNTGEQSG');
|
||||
expect(score).toEqual(118);
|
||||
});
|
||||
});
|
||||
196
src/mol-model/sequence/alignment/alignment.ts
Normal file
196
src/mol-model/sequence/alignment/alignment.ts
Normal file
@@ -0,0 +1,196 @@
|
||||
/**
|
||||
* Copyright (c) 2020 mol* contributors, licensed under MIT, See LICENSE file for more info.
|
||||
*
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { SubstitutionMatrix, SubstitutionMatrices, SubstitutionMatrixData } from './substitution-matrix';
|
||||
|
||||
const DefaultAlignmentOptions = {
|
||||
gapPenalty: -11,
|
||||
gapExtensionPenalty: -1,
|
||||
substMatrix: 'default' as SubstitutionMatrix | 'default'
|
||||
};
|
||||
export type AlignmentOptions = typeof DefaultAlignmentOptions;
|
||||
|
||||
export function align(seqA: ArrayLike<string>, seqB: ArrayLike<string>, options: Partial<AlignmentOptions> = {}) {
|
||||
const o = { ...DefaultAlignmentOptions, ...options };
|
||||
const alignment = new Alignment(seqA, seqB, o);
|
||||
alignment.calculate();
|
||||
return alignment.trace();
|
||||
}
|
||||
|
||||
class Alignment {
|
||||
readonly gapPenalty: number; readonly gapExtensionPenalty: number
|
||||
readonly substMatrix: SubstitutionMatrixData | undefined
|
||||
|
||||
readonly n: number; readonly m: number
|
||||
readonly S: number[][] = []; readonly V: number[][] = []; readonly H: number[][] = []
|
||||
|
||||
constructor (readonly seqA: ArrayLike<string>, readonly seqB: ArrayLike<string>, options: AlignmentOptions) {
|
||||
this.gapPenalty = options.gapPenalty;
|
||||
this.gapExtensionPenalty = options.gapExtensionPenalty;
|
||||
this.substMatrix = options.substMatrix === 'default' ? undefined : SubstitutionMatrices[options.substMatrix];
|
||||
|
||||
this.n = this.seqA.length;
|
||||
this.m = this.seqB.length;
|
||||
}
|
||||
|
||||
private initMatrices () {
|
||||
const { n, m, gapPenalty, S, V, H } = this;
|
||||
|
||||
for (let i = 0; i <= n; ++i) {
|
||||
S[i] = [], V[i] = [], H[i] = [];
|
||||
|
||||
for (let j = 0; j <= m; ++j) {
|
||||
S[i][j] = 0, V[i][j] = 0, H[i][j] = 0;
|
||||
}
|
||||
}
|
||||
|
||||
for (let i = 0; i <= n; ++i) {
|
||||
S[i][0] = gapPenalty;
|
||||
H[i][0] = -Infinity;
|
||||
}
|
||||
|
||||
for (let j = 0; j <= m; ++j) {
|
||||
S[0][j] = gapPenalty;
|
||||
V[0][j] = -Infinity;
|
||||
}
|
||||
|
||||
S[0][0] = 0;
|
||||
}
|
||||
|
||||
private makeScoreFn () {
|
||||
const { seqA, seqB, substMatrix } = this;
|
||||
|
||||
if (substMatrix) {
|
||||
return function score (i: number, j: number) {
|
||||
const cA = seqA[i];
|
||||
const cB = seqB[j];
|
||||
return substMatrix[cA]?.[cB] ?? -4;
|
||||
};
|
||||
} else {
|
||||
return function scoreNoSubstMat (i: number, j: number) {
|
||||
const cA = seqA[i];
|
||||
const cB = seqB[j];
|
||||
return cA === cB ? 5 : -3;
|
||||
};
|
||||
}
|
||||
}
|
||||
|
||||
calculate () {
|
||||
this.initMatrices();
|
||||
|
||||
const scoreFn = this.makeScoreFn();
|
||||
const { V, H, S, n, m, gapExtensionPenalty, gapPenalty } = this;
|
||||
|
||||
let Vi1, Si1, Vi, Hi, Si;
|
||||
for (let i = 1; i <= n; ++i) {
|
||||
Si1 = S[i - 1], Vi1 = V[i - 1];
|
||||
Vi = V[i], Hi = H[i], Si = S[i];
|
||||
|
||||
for (let j = 1; j <= m; ++j) {
|
||||
Vi[j] = Math.max(
|
||||
Si1[j] + gapPenalty,
|
||||
Vi1[j] + gapExtensionPenalty
|
||||
);
|
||||
|
||||
Hi[j] = Math.max(
|
||||
Si[j - 1] + gapPenalty,
|
||||
Hi[j - 1] + gapExtensionPenalty
|
||||
);
|
||||
|
||||
Si[j] = Math.max(
|
||||
Si1[j - 1] + scoreFn(i - 1, j - 1), // match
|
||||
Vi[j], // del
|
||||
Hi[j] // ins
|
||||
);
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
trace (): { aliA: ArrayLike<string>, aliB: ArrayLike<string>, score: number } {
|
||||
const scoreFn = this.makeScoreFn();
|
||||
const { V, H, S, seqA, seqB, gapExtensionPenalty, gapPenalty } = this;
|
||||
|
||||
let i = this.n;
|
||||
let j = this.m;
|
||||
let mat: 'S' | 'V' | 'H';
|
||||
let score: number;
|
||||
|
||||
let aliA = '';
|
||||
let aliB = '';
|
||||
|
||||
if (S[i][j] >= V[i][j]) {
|
||||
mat = 'S';
|
||||
score = S[i][j];
|
||||
} else if (V[i][j] >= H[i][j]) {
|
||||
mat = 'V';
|
||||
score = V[i][j];
|
||||
} else {
|
||||
mat = 'H';
|
||||
score = H[i][j];
|
||||
}
|
||||
|
||||
while (i > 0 && j > 0) {
|
||||
if (mat === 'S') {
|
||||
if (S[i][j] === S[i - 1][j - 1] + scoreFn(i - 1, j - 1)) {
|
||||
aliA = seqA[i - 1] + aliA;
|
||||
aliB = seqB[j - 1] + aliB;
|
||||
--i;
|
||||
--j;
|
||||
mat = 'S';
|
||||
} else if (S[i][j] === V[i][j]) {
|
||||
mat = 'V';
|
||||
} else if (S[i][j] === H[i][j]) {
|
||||
mat = 'H';
|
||||
} else {
|
||||
--i;
|
||||
--j;
|
||||
}
|
||||
} else if (mat === 'V') {
|
||||
if (V[i][j] === V[i - 1][j] + gapExtensionPenalty) {
|
||||
aliA = seqA[i - 1] + aliA;
|
||||
aliB = '-' + aliB;
|
||||
--i;
|
||||
mat = 'V';
|
||||
} else if (V[i][j] === S[i - 1][j] + gapPenalty) {
|
||||
aliA = seqA[i - 1] + aliA;
|
||||
aliB = '-' + aliB;
|
||||
--i;
|
||||
mat = 'S';
|
||||
} else {
|
||||
--i;
|
||||
}
|
||||
} else if (mat === 'H') {
|
||||
if (H[i][j] === H[i][j - 1] + gapExtensionPenalty) {
|
||||
aliA = '-' + aliA;
|
||||
aliB = seqB[j - 1] + aliB;
|
||||
--j;
|
||||
mat = 'H';
|
||||
} else if (H[i][j] === S[i][j - 1] + gapPenalty) {
|
||||
aliA = '-' + aliA;
|
||||
aliB = seqB[j - 1] + aliB;
|
||||
--j;
|
||||
mat = 'S';
|
||||
} else {
|
||||
--j;
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
while (i > 0) {
|
||||
aliA = seqA[i - 1] + aliA;
|
||||
aliB = '-' + aliB;
|
||||
--i;
|
||||
}
|
||||
|
||||
while (j > 0) {
|
||||
aliA = '-' + aliA;
|
||||
aliB = seqB[j - 1] + aliB;
|
||||
--j;
|
||||
}
|
||||
|
||||
return { aliA, aliB, score };
|
||||
}
|
||||
}
|
||||
110
src/mol-model/sequence/alignment/sequence.ts
Normal file
110
src/mol-model/sequence/alignment/sequence.ts
Normal file
@@ -0,0 +1,110 @@
|
||||
/**
|
||||
* Copyright (c) 2020 mol* contributors, licensed under MIT, See LICENSE file for more info.
|
||||
*
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { StructureElement, Unit } from '../../structure/structure';
|
||||
import { AlignmentOptions, align } from './alignment';
|
||||
import { OrderedSet } from '../../../mol-data/int';
|
||||
|
||||
export { AlignSequences };
|
||||
|
||||
namespace AlignSequences {
|
||||
export type Input = {
|
||||
a: StructureElement.Loci.Element,
|
||||
b: StructureElement.Loci.Element
|
||||
}
|
||||
/** `a` and `b` contain matching pairs, i.e. `a.indices[0]` aligns with `b.indices[0]` */
|
||||
export type Result = {
|
||||
a: StructureElement.Loci.Element,
|
||||
b: StructureElement.Loci.Element,
|
||||
score: number
|
||||
}
|
||||
|
||||
function createSeqIdIndicesMap(element: StructureElement.Loci.Element) {
|
||||
const seqIds = new Map<number, StructureElement.UnitIndex[]>();
|
||||
if (Unit.isAtomic(element.unit)) {
|
||||
const { label_seq_id } = element.unit.model.atomicHierarchy.residues;
|
||||
const { residueIndex } = element.unit;
|
||||
for (let i = 0, il = OrderedSet.size(element.indices); i < il; ++i) {
|
||||
const uI = OrderedSet.getAt(element.indices, i);
|
||||
const eI = element.unit.elements[uI];
|
||||
const seqId = label_seq_id.value(residueIndex[eI]);
|
||||
if (seqIds.has(seqId)) seqIds.get(seqId)!.push(uI);
|
||||
else seqIds.set(seqId, [uI]);
|
||||
}
|
||||
} else if (Unit.isCoarse(element.unit)) {
|
||||
const { seq_id_begin } = Unit.isSpheres(element.unit)
|
||||
? element.unit.model.coarseHierarchy.spheres
|
||||
: element.unit.model.coarseHierarchy.gaussians;
|
||||
for (let i = 0, il = OrderedSet.size(element.indices); i < il; ++i) {
|
||||
const uI = OrderedSet.getAt(element.indices, i);
|
||||
const eI = element.unit.elements[uI];
|
||||
const seqId = seq_id_begin.value(eI);
|
||||
seqIds.set(seqId, [uI]);
|
||||
}
|
||||
}
|
||||
return seqIds;
|
||||
}
|
||||
|
||||
export function compute(input: Input, options: Partial<AlignmentOptions> = {}): Result {
|
||||
const seqA = getSequence(input.a.unit);
|
||||
const seqB = getSequence(input.b.unit);
|
||||
|
||||
const seqIdIndicesA = createSeqIdIndicesMap(input.a);
|
||||
const seqIdIndicesB = createSeqIdIndicesMap(input.b);
|
||||
|
||||
const indicesA: StructureElement.UnitIndex[] = [];
|
||||
const indicesB: StructureElement.UnitIndex[] = [];
|
||||
const { aliA, aliB, score } = align(seqA.code.toArray(), seqB.code.toArray(), options);
|
||||
|
||||
let seqIdxA = 0, seqIdxB = 0;
|
||||
for (let i = 0, il = aliA.length; i < il; ++i) {
|
||||
if (aliA[i] === '-' || aliB[i] === '-') {
|
||||
if (aliA[i] !== '-') seqIdxA += 1;
|
||||
if (aliB[i] !== '-') seqIdxB += 1;
|
||||
continue;
|
||||
}
|
||||
|
||||
const seqIdA = seqA.seqId.value(seqIdxA);
|
||||
const seqIdB = seqB.seqId.value(seqIdxB);
|
||||
|
||||
if (seqIdIndicesA.has(seqIdA) && seqIdIndicesB.has(seqIdB)) {
|
||||
const iA = seqIdIndicesA.get(seqIdA)!;
|
||||
const iB = seqIdIndicesB.get(seqIdB)!;
|
||||
// use min length to guard against alternate locations
|
||||
for (let j = 0, jl = Math.min(iA.length, iB.length); j < jl; ++j) {
|
||||
indicesA.push(iA[j]);
|
||||
indicesB.push(iB[j]);
|
||||
}
|
||||
}
|
||||
|
||||
seqIdxA += 1, seqIdxB += 1;
|
||||
}
|
||||
|
||||
const outA = OrderedSet.intersect(OrderedSet.ofSortedArray(indicesA), input.a.indices);
|
||||
const outB = OrderedSet.intersect(OrderedSet.ofSortedArray(indicesB), input.b.indices);
|
||||
|
||||
return {
|
||||
a: { unit: input.a.unit, indices: outA },
|
||||
b: { unit: input.b.unit, indices: outB },
|
||||
score
|
||||
};
|
||||
}
|
||||
}
|
||||
|
||||
function entityKey(unit: Unit) {
|
||||
switch (unit.kind) {
|
||||
case Unit.Kind.Atomic:
|
||||
return unit.model.atomicHierarchy.index.getEntityFromChain(unit.chainIndex[unit.elements[0]]);
|
||||
case Unit.Kind.Spheres:
|
||||
return unit.model.coarseHierarchy.spheres.entityKey[unit.elements[0]];
|
||||
case Unit.Kind.Gaussians:
|
||||
return unit.model.coarseHierarchy.gaussians.entityKey[unit.elements[0]];
|
||||
}
|
||||
}
|
||||
|
||||
function getSequence(unit: Unit) {
|
||||
return unit.model.sequence.byEntityKey[entityKey(unit)].sequence;
|
||||
}
|
||||
81
src/mol-model/sequence/alignment/substitution-matrix.ts
Normal file
81
src/mol-model/sequence/alignment/substitution-matrix.ts
Normal file
@@ -0,0 +1,81 @@
|
||||
/**
|
||||
* Copyright (c) 2020 mol* contributors, licensed under MIT, See LICENSE file for more info.
|
||||
*
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
*/
|
||||
|
||||
import { Mutable } from '../../../mol-util/type-helpers';
|
||||
|
||||
const aminoacidsX = 'ACDEFGHIKLMNPQRSTVWY';
|
||||
const aminoacids = 'ARNDCQEGHILKMFPSTWYVBZX';
|
||||
|
||||
const blosum62x = [
|
||||
[4, 0, -2, -1, -2, 0, -2, -1, -1, -1, -1, -2, -1, -1, -1, 1, 0, 0, -3, -2], // A
|
||||
[0, 9, -3, -4, -2, -3, -3, -1, -3, -1, -1, -3, -3, -3, -3, -1, -1, -1, -2, -2], // C
|
||||
[-2, -3, 6, 2, -3, -1, -1, -3, -1, -4, -3, 1, -1, 0, -2, 0, -1, -3, -4, -3], // D
|
||||
[-1, -4, 2, 5, -3, -2, 0, -3, 1, -3, -2, 0, -1, 2, 0, 0, -1, -2, -3, -2], // E
|
||||
[-2, -2, -3, -3, 6, -3, -1, 0, -3, 0, 0, -3, -4, -3, -3, -2, -2, -1, 1, 3], // F
|
||||
[0, -3, -1, -2, -3, 6, -2, -4, -2, -4, -3, 0, -2, -2, -2, 0, -2, -3, -2, -3], // G
|
||||
[-2, -3, -1, 0, -1, -2, 8, -3, -1, -3, -2, 1, -2, 0, 0, -1, -2, -3, -2, 2], // H
|
||||
[-1, -1, -3, -3, 0, -4, -3, 4, -3, 2, 1, -3, -3, -3, -3, -2, -1, 3, -3, -1], // I
|
||||
[-1, -3, -1, 1, -3, -2, -1, -3, 5, -2, -1, 0, -1, 1, 2, 0, -1, -2, -3, -2], // K
|
||||
[-1, -1, -4, -3, 0, -4, -3, 2, -2, 4, 2, -3, -3, -2, -2, -2, -1, 1, -2, -1], // L
|
||||
[-1, -1, -3, -2, 0, -3, -2, 1, -1, 2, 5, -2, -2, 0, -1, -1, -1, 1, -1, -1], // M
|
||||
[-2, -3, 1, 0, -3, 0, 1, -3, 0, -3, -2, 6, -2, 0, 0, 1, 0, -3, -4, -2], // N
|
||||
[-1, -3, -1, -1, -4, -2, -2, -3, -1, -3, -2, -2, 7, -1, -2, -1, -1, -2, -4, -3], // P
|
||||
[-1, -3, 0, 2, -3, -2, 0, -3, 1, -2, 0, 0, -1, 5, 1, 0, -1, -2, -2, -1], // Q
|
||||
[-1, -3, -2, 0, -3, -2, 0, -3, 2, -2, -1, 0, -2, 1, 5, -1, -1, -3, -3, -2], // R
|
||||
[1, -1, 0, 0, -2, 0, -1, -2, 0, -2, -1, 1, -1, 0, -1, 4, 1, -2, -3, -2], // S
|
||||
[0, -1, -1, -1, -2, -2, -2, -1, -1, -1, -1, 0, -1, -1, -1, 1, 5, 0, -2, -2], // T
|
||||
[0, -1, -3, -2, -1, -3, -3, 3, -2, 1, 1, -3, -2, -2, -3, -2, 0, 4, -3, -1], // V
|
||||
[-3, -2, -4, -3, 1, -2, -2, -3, -3, -2, -1, -4, -4, -2, -3, -3, -2, -3, 11, 2], // W
|
||||
[-2, -2, -3, -2, 3, -3, 2, -1, -2, -1, -1, -2, -3, -1, -2, -2, -2, -1, 2, 7] // Y
|
||||
];
|
||||
|
||||
const blosum62 = [
|
||||
// A R N D C Q E G H I L K M F P S T W Y V B Z X
|
||||
[4, -1, -2, -2, 0, -1, -1, 0, -2, -1, -1, -1, -1, -2, -1, 1, 0, -3, -2, 0, -2, -1, 0], // A
|
||||
[-1, 5, 0, -2, -3, 1, 0, -2, 0, -3, -2, 2, -1, -3, -2, -1, -1, -3, -2, -3, -1, 0, -1], // R
|
||||
[-2, 0, 6, 1, -3, 0, 0, 0, 1, -3, -3, 0, -2, -3, -2, 1, 0, -4, -2, -3, 3, 0, -1], // N
|
||||
[-2, -2, 1, 6, -3, 0, 2, -1, -1, -3, -4, -1, -3, -3, -1, 0, -1, -4, -3, -3, 4, 1, -1], // D
|
||||
[0, -3, -3, -3, 9, -3, -4, -3, -3, -1, -1, -3, -1, -2, -3, -1, -1, -2, -2, -1, -3, -3, -2], // C
|
||||
[-1, 1, 0, 0, -3, 5, 2, -2, 0, -3, -2, 1, 0, -3, -1, 0, -1, -2, -1, -2, 0, 3, -1], // Q
|
||||
[-1, 0, 0, 2, -4, 2, 5, -2, 0, -3, -3, 1, -2, -3, -1, 0, -1, -3, -2, -2, 1, 4, -1], // E
|
||||
[0, -2, 0, -1, -3, -2, -2, 6, -2, -4, -4, -2, -3, -3, -2, 0, -2, -2, -3, -3, -1, -2, -1], // G
|
||||
[-2, 0, 1, -1, -3, 0, 0, -2, 8, -3, -3, -1, -2, -1, -2, -1, -2, -2, 2, -3, 0, 0, -1], // H
|
||||
[-1, -3, -3, -3, -1, -3, -3, -4, -3, 4, 2, -3, 1, 0, -3, -2, -1, -3, -1, 3, -3, -3, -1], // I
|
||||
[-1, -2, -3, -4, -1, -2, -3, -4, -3, 2, 4, -2, 2, 0, -3, -2, -1, -2, -1, 1, -4, -3, -1], // L
|
||||
[-1, 2, 0, -1, -3, 1, 1, -2, -1, -3, -2, 5, -1, -3, -1, 0, -1, -3, -2, -2, 0, 1, -1], // K
|
||||
[-1, -1, -2, -3, -1, 0, -2, -3, -2, 1, 2, -1, 5, 0, -2, -1, -1, -1, -1, 1, -3, -1, -1], // M
|
||||
[-2, -3, -3, -3, -2, -3, -3, -3, -1, 0, 0, -3, 0, 6, -4, -2, -2, 1, 3, -1, -3, -3, -1], // F
|
||||
[-1, -2, -2, -1, -3, -1, -1, -2, -2, -3, -3, -1, -2, -4, 7, -1, -1, -4, -3, -2, -2, -1, -2], // P
|
||||
[1, -1, 1, 0, -1, 0, 0, 0, -1, -2, -2, 0, -1, -2, -1, 4, 1, -3, -2, -2, 0, 0, 0], // S
|
||||
[0, -1, 0, -1, -1, -1, -1, -2, -2, -1, -1, -1, -1, -2, -1, 1, 5, -2, -2, 0, -1, -1, 0], // T
|
||||
[-3, -3, -4, -4, -2, -2, -3, -2, -2, -3, -2, -3, -1, 1, -4, -3, -2, 11, 2, -3, -4, -3, -2], // W
|
||||
[-2, -2, -2, -3, -2, -1, -2, -3, 2, -1, -1, -2, -1, 3, -3, -2, -2, 2, 7, -1, -3, -2, -1], // Y
|
||||
[0, -3, -3, -3, -1, -2, -2, -3, -3, 3, 1, -2, 1, -1, -2, -2, 0, -3, -1, 4, -3, -2, -1], // V
|
||||
[-2, -1, 3, 4, -3, 0, 1, -1, 0, -3, -4, 0, -3, -3, -2, 0, -1, -4, -3, -3, 4, 1, -1], // B
|
||||
[-1, 0, 0, 1, -3, 3, 4, -2, 0, -3, -3, 1, -1, -3, -1, 0, -1, -3, -2, -2, 1, 4, -1], // Z
|
||||
[0, -1, -1, -1, -2, -1, -1, -1, -1, -1, -1, -1, -1, -1, -2, 0, 0, -2, -1, -1, -1, -1, -1] // X
|
||||
];
|
||||
|
||||
export type SubstitutionMatrixData = Readonly<{ [k: string]: Readonly<{ [k: string]: number }> }>;
|
||||
|
||||
function prepareMatrix (cellNames: string, mat: number[][]): SubstitutionMatrixData {
|
||||
let j: number;
|
||||
let i = 0;
|
||||
const matDict: Mutable<SubstitutionMatrixData> = {};
|
||||
mat.forEach(row => {
|
||||
j = 0;
|
||||
const rowDict: { [k: string]: number } = {};
|
||||
row.forEach(elm => rowDict[cellNames[j++]] = elm);
|
||||
matDict[cellNames[i++]] = rowDict;
|
||||
});
|
||||
return matDict;
|
||||
}
|
||||
|
||||
export const SubstitutionMatrices = (() => ({
|
||||
blosum62: prepareMatrix(aminoacids, blosum62),
|
||||
blosum62x: prepareMatrix(aminoacidsX, blosum62x)
|
||||
}))();
|
||||
export type SubstitutionMatrix = keyof typeof SubstitutionMatrices;
|
||||
@@ -1,5 +1,5 @@
|
||||
/**
|
||||
* Copyright (c) 2018-2019 mol* contributors, licensed under MIT, See LICENSE file for more info.
|
||||
* Copyright (c) 2018-2020 mol* contributors, licensed under MIT, See LICENSE file for more info.
|
||||
*
|
||||
* @author David Sehnal <david.sehnal@gmail.com>
|
||||
* @author Alexander Rose <alexander.rose@weirdbyte.de>
|
||||
@@ -9,7 +9,6 @@ import { AminoAlphabet, NuclecicAlphabet, getProteinOneLetterCode, getRnaOneLett
|
||||
import { Column } from '../../mol-data/db';
|
||||
|
||||
// TODO add mapping support to other sequence spaces, e.g. uniprot
|
||||
// TODO sequence alignment (take NGL code as starting point)
|
||||
|
||||
type Sequence = Sequence.Protein | Sequence.DNA | Sequence.RNA | Sequence.Generic
|
||||
|
||||
@@ -24,14 +23,18 @@ namespace Sequence {
|
||||
export interface Base<K extends Kind, Alphabet extends string> {
|
||||
readonly kind: K,
|
||||
readonly length: number,
|
||||
readonly offset: number,
|
||||
|
||||
/** One letter code */
|
||||
readonly code: Column<Alphabet>
|
||||
readonly label: Column<string>
|
||||
|
||||
readonly seqId: Column<number>
|
||||
/** Component id */
|
||||
readonly compId: Column<string>
|
||||
|
||||
/** returns index for given seqId */
|
||||
readonly index: (seqId: number) => number
|
||||
|
||||
/** maps seqId to list of compIds */
|
||||
readonly microHet: ReadonlyMap<number, string[]>
|
||||
}
|
||||
@@ -41,11 +44,6 @@ namespace Sequence {
|
||||
export interface DNA extends Base<Kind.DNA, NuclecicAlphabet> { }
|
||||
export interface Generic extends Base<Kind.Generic, 'X' | '-'> { }
|
||||
|
||||
export function create<K extends Kind, Alphabet extends string>(kind: K, code: Column<Alphabet>, label: Column<string>, seqId: Column<number>, compId: Column<string>, microHet: Map<number, string[]>, offset: number = 0): Base<K, Alphabet> {
|
||||
const length = code.rowCount;
|
||||
return { kind, code, label, seqId, compId, microHet, offset, length };
|
||||
}
|
||||
|
||||
export function getSequenceString(seq: Sequence) {
|
||||
const array = seq.code.toArray();
|
||||
return (array instanceof Array ? array : Array.from(array)).join('');
|
||||
@@ -88,100 +86,60 @@ namespace Sequence {
|
||||
}
|
||||
|
||||
class ResidueNamesImpl<K extends Kind, Alphabet extends string> implements Base<K, Alphabet> {
|
||||
private _offset = 0;
|
||||
private _length = 0;
|
||||
private _microHet: ReadonlyMap<number, string[]> | undefined = void 0;
|
||||
private _code: Column<Alphabet> | undefined = undefined
|
||||
private _label: Column<string> | undefined = undefined
|
||||
public length: number
|
||||
public code: Column<Alphabet>
|
||||
public label: Column<string>
|
||||
public seqId: Column<number>
|
||||
public compId: Column<string>
|
||||
public microHet: ReadonlyMap<number, string[]> = new Map()
|
||||
|
||||
private codeFromName: (name: string) => string
|
||||
|
||||
get code(): Column<Alphabet> {
|
||||
if (this._code !== void 0) return this._code;
|
||||
this.create();
|
||||
return this._code!;
|
||||
private indexMap: Map<number, number>
|
||||
index(seqId: number) {
|
||||
return this.indexMap.get(seqId)!;
|
||||
}
|
||||
|
||||
get label(): Column<string> {
|
||||
if (this._label !== void 0) return this._label;
|
||||
this.create();
|
||||
return this._label!;
|
||||
}
|
||||
constructor(public kind: K, compId: Column<string>, seqId: Column<number>) {
|
||||
const codeFromName = codeProvider(kind);
|
||||
const codes: string[] = [];
|
||||
const compIds: string[] = [];
|
||||
const seqIds: number[] = [];
|
||||
const microHet = new Map<number, string[]>();
|
||||
|
||||
get offset() {
|
||||
if (this._code !== void 0) return this._offset;
|
||||
this.create();
|
||||
return this._offset;
|
||||
}
|
||||
let idx = 0;
|
||||
const indexMap = new Map<number, number>();
|
||||
for (let i = 0, il = seqId.rowCount; i < il; ++i) {
|
||||
const seq_id = seqId.value(i);
|
||||
|
||||
get length() {
|
||||
if (this._code !== void 0) return this._length;
|
||||
this.create();
|
||||
return this._length;
|
||||
}
|
||||
|
||||
get microHet(): ReadonlyMap<number, string[]> {
|
||||
if (this._microHet !== void 0) return this._microHet;
|
||||
this.create();
|
||||
return this._microHet!;
|
||||
}
|
||||
|
||||
private create() {
|
||||
let maxSeqId = 0, minSeqId = Number.MAX_SAFE_INTEGER;
|
||||
for (let i = 0, _i = this.seqId.rowCount; i < _i; i++) {
|
||||
const id = this.seqId.value(i);
|
||||
if (maxSeqId < id) maxSeqId = id;
|
||||
if (id < minSeqId) minSeqId = id;
|
||||
}
|
||||
|
||||
const count = maxSeqId - minSeqId + 1;
|
||||
const sequenceArray = new Array<string>(maxSeqId + 1);
|
||||
const labels = new Array<string[]>(maxSeqId + 1);
|
||||
for (let i = 0; i < count; i++) {
|
||||
sequenceArray[i] = '-';
|
||||
labels[i] = [];
|
||||
}
|
||||
|
||||
const compIds = new Array<string[]>(maxSeqId + 1);
|
||||
for (let i = minSeqId; i <= maxSeqId; ++i) {
|
||||
compIds[i] = [];
|
||||
}
|
||||
|
||||
for (let i = 0, _i = this.seqId.rowCount; i < _i; i++) {
|
||||
const seqId = this.seqId.value(i);
|
||||
const idx = seqId - minSeqId;
|
||||
const name = this.compId.value(i);
|
||||
const code = this.codeFromName(name);
|
||||
// in case of MICROHETEROGENEITY `sequenceArray[idx]` may already be set
|
||||
if (!sequenceArray[idx] || sequenceArray[idx] === '-') {
|
||||
sequenceArray[idx] = code;
|
||||
if (!indexMap.has(seq_id)) {
|
||||
indexMap.set(seq_id, idx);
|
||||
const comp_id = compId.value(i);
|
||||
compIds[idx] = comp_id;
|
||||
seqIds[idx] = seq_id;
|
||||
codes[idx] = codeFromName(comp_id);
|
||||
idx += 1;
|
||||
} else {
|
||||
// micro-heterogeneity
|
||||
if (!microHet.has(seq_id)) {
|
||||
microHet.set(seq_id, [compIds[indexMap.get(seq_id)!], compId.value(i)]);
|
||||
} else {
|
||||
microHet.get(seq_id)!.push(compId.value(i));
|
||||
}
|
||||
}
|
||||
labels[idx].push(code === 'X' ? name : code);
|
||||
compIds[seqId].push(name);
|
||||
}
|
||||
|
||||
const microHet = new Map();
|
||||
for (let i = minSeqId; i <= maxSeqId; ++i) {
|
||||
if (compIds[i].length > 1) microHet.set(i, compIds[i]);
|
||||
const labels: string[] = [];
|
||||
for (let i = 0, il = idx; i < il; ++i) {
|
||||
const mh = microHet.get(seqIds[i]);
|
||||
labels[i] = mh ? `(${mh.join('|')})` : codes[i];
|
||||
}
|
||||
|
||||
this._code = Column.ofStringArray(sequenceArray) as Column<Alphabet>;
|
||||
this._label = Column.ofLambda({
|
||||
value: i => {
|
||||
const l = labels[i];
|
||||
return l.length > 1 ? `(${l.join('|')})` : l.join('');
|
||||
},
|
||||
rowCount: labels.length,
|
||||
schema: Column.Schema.str
|
||||
});
|
||||
this._microHet = microHet;
|
||||
this._offset = minSeqId - 1;
|
||||
this._length = count;
|
||||
}
|
||||
|
||||
constructor(public kind: K, public compId: Column<string>, public seqId: Column<number>) {
|
||||
|
||||
this.codeFromName = codeProvider(kind);
|
||||
this.length = idx;
|
||||
this.code = Column.ofStringArray(codes) as Column<Alphabet>;
|
||||
this.compId = Column.ofStringArray(compIds);
|
||||
this.seqId = Column.ofIntArray(seqIds);
|
||||
this.label = Column.ofStringArray(labels);
|
||||
this.microHet = microHet;
|
||||
this.indexMap = indexMap;
|
||||
}
|
||||
}
|
||||
|
||||
@@ -192,13 +150,17 @@ namespace Sequence {
|
||||
}
|
||||
|
||||
class SequenceRangesImpl<K extends Kind, Alphabet extends string> implements Base<K, Alphabet> {
|
||||
public offset: number
|
||||
public length: number
|
||||
public code: Column<Alphabet>
|
||||
public label: Column<string>
|
||||
public seqId: Column<number>
|
||||
public compId: Column<string>
|
||||
public microHet: ReadonlyMap<number, string[]>
|
||||
public microHet: ReadonlyMap<number, string[]> = new Map()
|
||||
|
||||
private minSeqId: number
|
||||
index(seqId: number) {
|
||||
return seqId - this.minSeqId;
|
||||
}
|
||||
|
||||
constructor(public kind: K, private seqIdStart: Column<number>, private seqIdEnd: Column<number>) {
|
||||
let maxSeqId = 0, minSeqId = Number.MAX_SAFE_INTEGER;
|
||||
@@ -220,8 +182,8 @@ namespace Sequence {
|
||||
});
|
||||
this.compId = Column.ofConst('', count, Column.Schema.str);
|
||||
|
||||
this.offset = minSeqId - 1;
|
||||
this.length = count;
|
||||
this.minSeqId = minSeqId;
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
@@ -9,5 +9,4 @@ export * from './structure/coordinates';
|
||||
export * from './structure/topology';
|
||||
export * from './structure/model';
|
||||
export * from './structure/structure';
|
||||
export * from './structure/query';
|
||||
export * from './structure/common/custom-property';
|
||||
export * from './structure/query';
|
||||
@@ -15,7 +15,7 @@ import { _chem_comp, _pdbx_chem_comp_identifier, _pdbx_nonpoly_scheme } from './
|
||||
import { Model } from '../model';
|
||||
import { getUniqueEntityIndicesFromStructures, copy_mmCif_category, copy_source_mmCifCategory } from './categories/utils';
|
||||
import { _struct_asym, _entity_poly, _entity_poly_seq } from './categories/sequence';
|
||||
import { CustomPropertyDescriptor } from '../common/custom-property';
|
||||
import { CustomPropertyDescriptor } from '../../custom-property';
|
||||
import { atom_site_operator_mapping } from './categories/atom_site_operator_mapping';
|
||||
import { MmcifFormat } from '../../../mol-model-formats/structure/mmcif';
|
||||
|
||||
|
||||
@@ -10,9 +10,9 @@ import StructureSequence from './properties/sequence';
|
||||
import { AtomicHierarchy, AtomicConformation, AtomicRanges } from './properties/atomic';
|
||||
import { CoarseHierarchy, CoarseConformation } from './properties/coarse';
|
||||
import { Entities, ChemicalComponentMap, MissingResidues, StructAsymMap } from './properties/common';
|
||||
import { CustomProperties } from '../common/custom-property';
|
||||
import { CustomProperties } from '../../custom-property';
|
||||
import { SaccharideComponentMap } from '../structure/carbohydrates/constants';
|
||||
import { ModelFormat } from '../../../mol-model-formats/structure/format';
|
||||
import { ModelFormat } from '../../../mol-model-formats/format';
|
||||
import { calcModelCenter } from './util';
|
||||
import { Vec3 } from '../../../mol-math/linear-algebra';
|
||||
import { Mutable } from '../../../mol-util/type-helpers';
|
||||
|
||||
Some files were not shown because too many files have changed in this diff Show More
Reference in New Issue
Block a user