Files
AlphaPulldown/test/test_data/features/test_complex.json
Dima fc41c1a5eb AF3 templates: fix mmCIF parsing by removing synthetic _entity_poly_seq and mapping only present residues
- Strip _entity_poly_seq from generated template mmCIF so AF3 reconstructs _pdbx_poly_seq_scheme from _atom_site, avoiding UNK/gap mismatches
- Build query_to_template_map using only residues with atoms to prevent OOB indexing in template features
- Add --debug_templates flag to optionally dump generated template mmCIFs into templates_debug/
- Keep templates enabled; test test__chopped_dimer now passes
2025-08-12 14:04:33 +02:00

58 lines
1.2 KiB
JSON

{
"dialect": "alphafold3",
"version": 1,
"name": "test_complex",
"modelSeeds": [42],
"sequences": [
{
"protein": {
"id": "A",
"sequence": "MESAIAEGGASRFSASSGGGGSRGAPQHYPKTAGNSEFLGKTPGQNAQKWIPARSTRRDDNSAA",
"modifications": [
{"ptmType": "HY3", "ptmPosition": 1},
{"ptmType": "P1L", "ptmPosition": 5}
],
"unpairedMsa": null,
"pairedMsa": null,
"templates": []
}
},
{
"dna": {
"id": "B",
"sequence": "GATTACA",
"modifications": [
{"modificationType": "6OG", "basePosition": 1},
{"modificationType": "6MA", "basePosition": 2}
]
}
},
{
"rna": {
"id": "C",
"sequence": "AGCU",
"modifications": [
{"modificationType": "2MG", "basePosition": 1},
{"modificationType": "5MC", "basePosition": 4}
]
}
},
{
"ligand": {
"id": "D",
"ccdCodes": ["ATP"]
}
},
{
"ligand": {
"id": "E",
"ccdCodes": ["HEM"]
}
}
],
"bondedAtomPairs": [
[["A", 1, "CA"], ["D", 1, "CHA"]],
[["A", 5, "SG"], ["E", 1, "C04"]]
],
"userCCD": null
}