mirror of
https://github.com/KosinskiLab/AlphaPulldown.git
synced 2026-06-04 22:34:26 +08:00
- Strip _entity_poly_seq from generated template mmCIF so AF3 reconstructs _pdbx_poly_seq_scheme from _atom_site, avoiding UNK/gap mismatches - Build query_to_template_map using only residues with atoms to prevent OOB indexing in template features - Add --debug_templates flag to optionally dump generated template mmCIFs into templates_debug/ - Keep templates enabled; test test__chopped_dimer now passes
58 lines
1.2 KiB
JSON
58 lines
1.2 KiB
JSON
{
|
|
"dialect": "alphafold3",
|
|
"version": 1,
|
|
"name": "test_complex",
|
|
"modelSeeds": [42],
|
|
"sequences": [
|
|
{
|
|
"protein": {
|
|
"id": "A",
|
|
"sequence": "MESAIAEGGASRFSASSGGGGSRGAPQHYPKTAGNSEFLGKTPGQNAQKWIPARSTRRDDNSAA",
|
|
"modifications": [
|
|
{"ptmType": "HY3", "ptmPosition": 1},
|
|
{"ptmType": "P1L", "ptmPosition": 5}
|
|
],
|
|
"unpairedMsa": null,
|
|
"pairedMsa": null,
|
|
"templates": []
|
|
}
|
|
},
|
|
{
|
|
"dna": {
|
|
"id": "B",
|
|
"sequence": "GATTACA",
|
|
"modifications": [
|
|
{"modificationType": "6OG", "basePosition": 1},
|
|
{"modificationType": "6MA", "basePosition": 2}
|
|
]
|
|
}
|
|
},
|
|
{
|
|
"rna": {
|
|
"id": "C",
|
|
"sequence": "AGCU",
|
|
"modifications": [
|
|
{"modificationType": "2MG", "basePosition": 1},
|
|
{"modificationType": "5MC", "basePosition": 4}
|
|
]
|
|
}
|
|
},
|
|
{
|
|
"ligand": {
|
|
"id": "D",
|
|
"ccdCodes": ["ATP"]
|
|
}
|
|
},
|
|
{
|
|
"ligand": {
|
|
"id": "E",
|
|
"ccdCodes": ["HEM"]
|
|
}
|
|
}
|
|
],
|
|
"bondedAtomPairs": [
|
|
[["A", 1, "CA"], ["D", 1, "CHA"]],
|
|
[["A", 5, "SG"], ["E", 1, "C04"]]
|
|
],
|
|
"userCCD": null
|
|
} |